KEGG   Methylovorus glucosetrophus: Msip34_1746Help
Entry
Msip34_1746       CDS       T00943                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mei  Methylovorus glucosetrophus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mei00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Msip34_1746
Enzymes [BR:mei01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Msip34_1746
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Msip34_1746
Lipid biosynthesis proteins [BR:mei01004]
 Fatty acid synthase
  Component type
   Msip34_1746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1853340..1853924
Genome map
AA seq 194 aa AA seqDB search
MAAAPSSNSAPVILVFGDSLSAGYGIPRESGWVSLLQQRLQQRGLPHRVVNASISGETTS
GGLSRIAEAVRSHQPSLVLVELGANDGLRGLPVEQMQQNLNKIIATNEAAKARTILIGMM
IPPNYGPRYTQSFNGSFRELAEAHKLPLVPFLLEGVAGNASLNQDDGLHPRAEAQERLLD
NVWKVLAPALKIAP
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcgccatccagcaattctgcacccgtcattctggtgttcggcgacagcctt
tcggctggctatggtattccgcgtgaatcgggctgggtcagcctgctgcagcagcgtctg
caacaacgcgggctgccgcatcgtgtcgtcaatgccagcatcagcggcgaaaccaccagc
ggtggcctgagccgcatcgccgaggccgtgcgctcgcatcagccctcgctggtgctggtg
gagctgggggcgaatgacggcctgcgtggccttcccgttgagcagatgcagcaaaacctc
aacaagatcatcgccaccaacgaggctgccaaggccaggaccatcctgatcggcatgatg
attccccccaactatggccctcgttatacgcaatcgttcaatggcagcttccgcgagttg
gcagaagcgcacaaattgccgctggtgccctttctgctggaaggcgtggcaggcaatgcc
agcctgaatcaggacgatgggctgcacccacgtgccgaagctcaggagcgattgctggat
aacgtatggaaggtgctggcacctgcactgaaaatcgcgccttaa

DBGET integrated database retrieval system