KEGG   Methylovorus glucosetrophus SIP3-4: Msip34_1872Help
Entry
Msip34_1872       CDS       T00943                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mei  Methylovorus glucosetrophus SIP3-4
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mei00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1985466..1986287)
Genome map
AA seq 273 aa AA seqDB search
MKFICGRYQLDLSRPHVMGIVNVTPDSFSDGGKYSSTELAVAHAIELVEQGADILDIGGE
STRPGATPVSLEDELQRVLPVIEQLAERVDVPLSIDTYKPEVMRAAIAAGADIVNDVRAL
QEPHALEIVAASNVGVCLMHMQGTPQTMQLEPQYDDVVTEVAGFLQSRLQAAQAAGIAAE
RITLDPGFGFGKRTVHNIALLQQLPVLQALGYPLLVGLSRKSVLGKITGEDVDSRLYASL
AASVIATMKGAAIVRVHDVKATAEALKVVAAVR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatctgcggtcgttaccaactggatctttcgcgccctcatgtcatgggcatc
gtcaatgtcacacctgactctttttcagatggtggcaaatattcctctaccgagctcgcg
gtggcgcatgccattgaactggtcgagcagggcgcggacatcctcgatataggcggcgaa
tccacccgcccgggggcaacgccagtctcgctggaggatgagctgcagcgcgtcttgccg
gtgatcgagcaattggcagagcgcgtggatgtgccgctttcgattgatacctacaagccg
gaagtcatgcgggccgctatcgccgccggggctgatatcgtgaatgatgtcagggccttg
caggagccacatgcgctcgagattgtggcggcaagcaatgttggcgtttgcctcatgcat
atgcaaggcacgccgcagaccatgcaactggaaccgcaatatgatgatgtggtgaccgag
gttgccggttttctgcaaagccgcttgcaggcggctcaggcagccgggatagcagccgag
cgcatcacgcttgatccgggctttggtttcggcaagcgtactgtgcataatattgccctg
ctgcagcaattgccggtattgcaggcgctgggctatcctttactggtcggtctttcgcgc
aaatctgtgctgggcaaaattacaggtgaggatgtcgactcccgcctgtatgccagtctg
gcggcctccgtgattgccaccatgaaaggggctgccattgtgcgggtgcatgatgtcaaa
gccaccgcggaagcgctgaaagtggtggcagccgtccgctag

DBGET integrated database retrieval system