KEGG   Methylovorus glucosetrophus: Msip34_2627Help
Entry
Msip34_2627       CDS       T00943                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mei  Methylovorus glucosetrophus
Brite
Enzymes [BR:mei01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Msip34_2627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 MTS Methyltransf_18 Methyltransf_23 Methyltransf_12 Methyltransf_32 Methyltransf_4 Methyltransf_11 NodS GCD14 MetW DUF938 PrmA CMAS TehB tRNA_U5-meth_tr
Motif
Other DBs
NCBI-ProteinID: ACT51864
JGI: Msip34_2627
UniProt: C6XB94
Position
2766291..2766953
Genome map
AA seq 220 aa AA seqDB search
MMHKDVEQARFNMIEQQIRTWEVLDARVLDLLSQVPREDFVPEQYRGLAFADLEIPIGAG
QQMLSPKMEGRIVQALEVSKTDRVLEIGTGSGYLTALLATLAKEVISLEVEADLSVAAQR
KLQQHGIHNVSLEIADGSQGWANGAPYDVIVFTASLPLLPVIAERQLAINGRLFAVVGEG
PAMEATMIRRVSADSFRHDVLFETSLPPLANAPQPARFEF
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatgcataaggatgtagaacaagcacgttttaacatgattgagcagcagatccgcaca
tgggaagtgctggacgcccgcgtactggacctgttaagtcaggtgccgcgcgaggatttt
gtgccggagcaatatcgtggtctggcgtttgctgatctggaaatccccatcggcgctggt
cagcaaatgctttcacccaagatggaaggccgcatcgtacaggcattggaggtcagcaag
actgaccgcgtgctggaaattggcacgggcagtggttacctcaccgcattgctggcaacg
cttgccaaggaagtcatcagcctggaagttgaggcagatctcagtgtggcagcacaacga
aaactgcaacaacatggcatccacaacgtgagtctggaaattgccgatggcagccagggc
tgggccaatggcgcgccctacgatgtcatcgtgtttaccgcctcgctgccgctgctgccc
gtgattgccgagcgacaactcgccatcaacggccgcctgtttgctgttgtcggagagggg
ccggccatggaagccaccatgatccgtcgtgtcagcgcagacagtttccgtcacgatgtg
ctgtttgaaacatctttgcctccgcttgccaacgcgcctcaacctgctcgcttcgagttt
taa

DBGET integrated database retrieval system