KEGG   Methylovorus glucosetrophus: Msip34_2770Help
Entry
Msip34_2770       CDS       T00943                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
mei  Methylovorus glucosetrophus
Brite
Enzymes [BR:mei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Msip34_2770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2928028..2929896)
Genome map
AA seq 622 aa AA seqDB search
MQEKPTPIEIARQALMQLASRKVPPTPDNFRTVYDEIAGVVSTNETLELAHVLDKVLHDA
GKQRPKYIAAAQSIATLIEKKDWSRLEDQLIKLLPLGAAGGDETSWPVVIRNLLKQLEVS
HKGVTLTRKKEGLNRVLTNFGSDPDVLPQKIQSLVNSWGQGSVADHVPGDGPQVLEGEAE
TIGETPTPAPSKSLYGKKPAEYWREMLVRTMELVLIPQLHSLPEPEAKAKQLVKDINAAT
NETQIKRIAEELKSVLFTLEMHGDQQNRLHEALLQLLRLLNNSMGELVLEDKWLHGQTKI
VQDILEKPLDLTRLYDAESSLKELLYKQGQIKPRLIEAKDSLKRMAEIFVDRLAEMDTDT
GEYQNKLNGYRDRITSTEDLVELNSVIDSLLNDTRSIGLSIQRSKDALVDAQQRADEAEK
LIDELTRRLDHISEVAHEDYLTGTLNRRGMDEAMEREFARADRHGTPLSIAMMDIDHFKQ
LNDNLGHATGDQALIHLVRIVKYSLRNTDVLARYGGEEFIIILPSTKQDEAMDIMKRVQR
DLTKNFFMHRNERVLITFSAGVAERLPGEGPETIVPRADAALYKAKHSGRNQVIGAEALL
EEPEIREITDASAAEANGNNAA
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaaaccgacccccatcgagattgccaggcaggcattgatgcagcttgcctcg
cgcaaagtcccgcctacgccggataatttccgcacggtttatgacgagattgccggcgtc
gtatccaccaatgaaaccctggaactggcccatgtgctggacaaggttctgcacgacgct
ggcaagcaacgtcccaagtacattgccgccgcccaatccatcgccacgctcatcgagaaa
aaagactggtccaggctggaagatcagctcatcaagctattgcccctgggcgcagctggt
ggcgatgaaaccagttggcccgtggtcatccgcaacctgttgaagcagttggaagtcagc
cacaagggcgtcaccctgacgcgcaagaaagaaggccttaaccgggtgctgaccaacttc
ggcagtgaccccgatgtcttgccgcaaaagattcaatccctggtcaattcatggggccaa
ggttcggtggccgatcatgtaccgggtgacggaccgcaggtgctggaaggcgaagcggaa
accataggcgaaacgcccacccctgcccccagcaaatcgctgtatggcaaaaagcccgcc
gaatattggcgcgagatgctggtgcgtaccatggagctggtgctgattccgcaactgcat
tccctgcccgagccggaagccaaggccaaacagctggtcaaggatatcaatgccgccacc
aatgaaacccagatcaagcgtattgccgaagaattgaagagcgtgctgtttaccctggaa
atgcatggcgatcagcagaaccgcctgcatgaagccttgttgcagttattgcgactgctg
aacaacagcatgggtgagctggtgctggaggataaatggctgcatgggcagaccaaaatc
gtgcaggatatcctcgaaaaaccgctggatcttacccggctctatgacgccgaaagcagc
ttgaaagagttgctgtacaagcaggggcagatcaagccacgcctgattgaagccaaagac
tcgctgaagcggatggccgaaatctttgtggacagactggccgagatggacaccgatacc
ggtgaataccagaacaagctgaatggctatcgcgaccgcatcacgtcgaccgaagatctg
gtggaactcaactcggtgatcgacagcctgctcaacgatacccgcagcataggcctgagc
atacagcgttccaaggatgcgctggtggatgcgcagcaacgcgctgacgaggcggaaaag
ctgattgatgagctgacgcgccgtctggaccatatcagcgaagtggcgcatgaagactac
ctcaccggcacactcaaccgccgcggcatggatgaagccatggagcgcgaatttgcccgt
gccgaccggcatggtacgccgctcagtattgccatgatggatatcgaccacttcaagcag
ctcaacgataacctggggcatgcgactggcgaccaggccttgatccatctggtgcgcatc
gttaaatactcgctgcgcaataccgatgtgctggcgcgctacggtggcgaggagttcatc
atcatactgcccagtaccaagcaggatgaggccatggacatcatgaagcgcgtacagcgg
gatctcaccaaaaacttcttcatgcatcgcaacgagcgtgtgctgatcacctttagcgcc
ggggtcgccgaacggctaccgggcgaggggccggaaactatcgtgccgcgtgctgatgct
gcgctctacaaggccaagcacagcggtcgcaatcaggtgattggcgcggaagccttgctg
gaagagcccgagatacgtgaaattaccgatgccagtgcggcagaggctaacggtaataat
gcggcttaa

DBGET integrated database retrieval system