KEGG   Methylophaga nitratireducenticrescens: Q7A_1011Help
Entry
Q7A_1011          CDS       T02055                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej00300  Lysine biosynthesis
mej00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Q7A_1011
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Q7A_1011
Enzymes [BR:mej01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Q7A_1011
Peptidoglycan biosynthesis and degradation proteins [BR:mej01011]
 Precursor biosynthesis
  Amino acid ligase
   Q7A_1011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: AFI83853
UniProt: I1XHI4
Position
1017860..1019380
Genome map
AA seq 506 aa AA seqDB search
MNYQMRLIDLMQLVDSDTVSTTVVTGLSLDSRRLKSGDLFFALATDLEIRAQHIKQAATA
EIAAVCYSAEAPLNPEQRKNLQKRQIEMVAVDDLKEQTARLAAAFYQYPSATMTVIAVTG
TNGKTSVTQFIAQALENAGQPCGVIGTLGSGRITEIKDHGMTTPDPVRLQAMLAEMRDSG
IRYVAVEASSHALEQGRLNFVDINYAVLTNLSRDHLDYHQNMEEYAAAKQRLFDFASLEA
AVVNADDDFGQQILSLLNNNQITSVEYSCRNSKASLFASDIQPTTNGLQFNLHNAQQTLA
IQTRLLGRFNVENLLATAGVLALVGWSTSEIADGLNQLTSVNGRMQLLASSLQPSVVIDF
AHTPDALEKALLGMRQHMDSSSKLWCVFGCGGERDKGKRPLMGKTVSELADKLVVTDDNP
RGEKSMEIIEQILTGCHKQADIHIEADRKLAIEYAIIDSALDDMVLIAGKGHEQFQEVAG
VKTPFNDNEIAMQAIQKRHSATRVTL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaactatcaaatgcgtcttattgatttaatgcagcttgtggatagtgacacggtgtcg
acaacagtggtcaccggcctcagtctggatagccgtcgactcaagtcaggagatttgttt
tttgccttagctacggatttagaaatccgagcccaacatatcaagcaggcagctacagcc
gaaattgcagctgtttgctattcagcagaagcacctttgaacccggagcagagaaaaaat
ctgcaaaaacggcaaatagagatggttgctgttgatgatttaaaggagcaaaccgctcgc
ctggccgcggcattctatcaatatccttctgcaacgatgactgtgatagcggtaaccggt
accaatggtaaaacctctgtcacccagtttatcgctcaggcactggaaaacgccggtcaa
ccttgtggtgtgataggaacattgggcagtggaagaataactgagataaaagatcacggc
atgaccacgccggatcccgtccgtttacaagcaatgcttgccgaaatgcgtgacagtgga
attcggtacgtcgctgttgaagcatcctcacatgctttggaacagggacgactgaatttt
gtggatattaactatgccgtattgaccaatttaagtcgggatcatcttgattatcaccag
aatatggaagaatacgcggcggcaaaacaacgtttatttgattttgcgtcactagaggct
gcagtagtaaatgctgacgatgactttggtcagcagatattgtctttactcaataacaat
cagattaccagtgtggagtatagctgccgcaattccaaagccagcctgtttgccagtgat
attcagccgacaacgaatggtttgcaattcaatttacataatgcacagcaaacattggcc
attcaaacccggttactgggcagattcaatgtcgaaaatctattggcaaccgccggtgta
cttgcgttagttggttggtcaacgagtgaaattgcagacggattaaatcaattaaccagt
gtaaatggacgtatgcaactgttggcgagcagtctgcagccgtcagtcgtgattgatttt
gcccataccccggacgcattggaaaaagccttgctgggcatgcgtcagcatatggatagc
agttcaaaactctggtgtgtatttggttgtggcggtgagcgcgacaaaggcaaacggcca
ttgatggggaaaaccgtcagtgagttggccgacaaactggtcgttaccgatgacaatccg
cgtggtgagaaaagtatggaaatcatcgagcagatcctgactggttgccacaagcaagca
gatattcatattgaagccgatagaaagctagcgatcgaatacgccattatcgattcagct
cttgatgacatggtccttatcgccggaaaaggccatgaacaatttcaggaagtggctggc
gtaaaaacaccttttaatgataacgagatagcgatgcaggccatacaaaaacgtcactca
gcaacaagggtaaccttatga

DBGET integrated database retrieval system