KEGG   Methylophaga nitratireducenticrescens: Q7A_1061Help
Entry
Q7A_1061          CDS       T02055                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mej  Methylophaga nitratireducenticrescens
Brite
Enzymes [BR:mej01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Q7A_1061
Secretion system [BR:mej02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Q7A_1061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1073599..1074318
Genome map
AA seq 239 aa AA seqDB search
MNLSRLVWLPLLLCMGLAHADEMSELKAELNKQLPDMQLQSLAPVGQSGLYEAVIDDRIY
YFTADGQFLIQGDLLALETRENITEARRTEVKKTLLDRIEEDDLIIFAAKKPDYTVTVFT
DVDCGYCRELHRQVKNYNDLGITIRYMAYPRAGAESESANKLIEVWCAKDQQKAMTDAKA
QREVKKTSLCENNPVAEQFEIGGKLGVRGTPAIFLEDGQMLPGYVPPQKLREILDEYLG
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaagccgattggtatggttgccgttattgctctgcatgggcctggcgcatgca
gatgagatgtcagagctcaaagccgaactcaacaaacaattacccgatatgcagttgcaa
tcattagcaccagttggccaaagtggtttatatgaagctgttattgatgatcgtatttac
tacttcacggcagatggtcaatttttgattcaaggtgatttactggcgctggaaacgcgt
gaaaacattactgaagcgcgtcgtacggaagtgaaaaagactttactggatcgtatagaa
gaagatgatctgattatttttgccgccaaaaaaccggactacactgttaccgtctttact
gatgttgattgtggttattgccgtgagttgcatcggcaggtaaaaaactacaacgatttg
ggcatcactattcgctatatggcttaccctcgcgcaggtgcagaatccgaatcagctaat
aaattaattgaagtctggtgtgccaaggatcagcagaaagccatgacggatgcgaaagcc
cagcgcgaagtgaaaaaaacatctctctgtgaaaataatccagtagccgagcagtttgaa
attggtggcaagttgggagtgcgtggtacgccggcaatcttcctggaagatggtcagatg
ttacccggatatgtgccaccgcagaaattgcgcgaaattctggatgaatatctcggctag

DBGET integrated database retrieval system