KEGG   Methylophaga nitratireducenticrescens: Q7A_1159Help
Entry
Q7A_1159          CDS       T02055                                 

Definition
N-succinyl-L,L-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Q7A_1159
  Amino acid metabolism
   00300 Lysine biosynthesis
    Q7A_1159
Enzymes [BR:mej01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Q7A_1159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1174427..1175569)
Genome map
AA seq 380 aa AA seqDB search
MQNNLSDTVQLTIDLIQRDSVTPVDKGCQIMLAERLANSGFNAEYLRFGEVDNLWCRRGH
NGPLFVFAGHTDVVPTGPVDKWSYEPFAAKIEDGILYGRGTADMKGSIAAMVTACERFVA
EHPQHAGSIAFLLTSDEEGPATDGTVKVIETLQARQDHIDWCVVGEPTSTDKVADVVKNG
RRGSLNGYLTVQGKQGHIAYPHLADNPVHKLAPALAELCAMQWDQGNADFPPTSFQVSNL
NSGTGATNIIPGTAELIFNFRYSTEVTHDELQQQVEAILDKHGVAYQLDWVLSGKPFRTA
GGKLLEAVQVAVKTVTGYETTLSTSGGTSDGRFIAPTGAQVIELGPLNATIHQIDEHVSV
ADLDTLSSIYQQLLTELLVN
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataatctttctgacactgttcagctcaccattgatttaattcaacgtgacagc
gtgacacctgtcgacaaaggctgtcagatcatgctggcagaacggttggcgaatagtggc
tttaatgctgaatacctgcgctttggggaagtcgacaatctgtggtgtcggcgggggcat
aatggcccgttatttgtatttgccggacataccgatgttgtgccaaccggaccggtagat
aaatggagctacgaaccgtttgccgccaaaattgaagacggcattttgtatggccgcggt
acagcagatatgaaaggcagtattgctgctatggtgacggcttgtgaacgttttgttgct
gaacatcctcagcatgctggcagcattgcttttttactgaccagcgatgaagagggtccg
gctaccgatggtacggttaaagtaattgaaacactgcaggcgcgtcaggatcatatcgac
tggtgcgtggtcggcgaaccgaccagtactgacaaagtagctgatgtggtcaaaaatggt
cgccgtggttcattgaatggctatctgacagttcaaggcaagcaaggccatattgcttat
ccacatctggcagataacccggtacataaactggccccggcattggctgaactgtgtgca
atgcaatgggatcaaggtaatgctgatttccctcccaccagctttcaggtatccaatctg
aacagcggcactggtgcgaccaatatcatcccaggcacagcagaattgatttttaacttc
cgttattccactgaagtgactcacgatgaattgcaacaacaggtcgaggcgattctcgat
aaacacggtgtggcatatcaattggattgggtgttatccggtaaaccctttcgtacagca
ggcggtaaattacttgaagccgttcaggtggcggttaaaaccgtcactggttatgaaaca
acgctctctacttcgggtggcacatccgatggtcgttttatcgcgcctactggagcacag
gtaattgaacttggcccgttaaacgcgacgattcatcagatagatgaacatgtttcagtt
gccgatctggatacattgtcatctatttatcaacaattgcttactgaattgctggtgaac
taa

DBGET integrated database retrieval system