KEGG   Methylophaga nitratireducenticrescens: Q7A_12Help
Entry
Q7A_12            CDS       T02055                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mej00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Q7A_12
Enzymes [BR:mej01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Q7A_12
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8002..8598)
Genome map
AA seq 198 aa AA seqDB search
MIGRLTGIIIEKQPPELVLDVNGVGYEVSAPMSTFVNLPSLNEKVSLYTHLVVREDAQLL
YGFATTRERLLFRSLLKVNGVGAKLALTILSGSDVDSFARSVQEGDAASLTRLPGVGKKT
ADRLIIEMRDRLKEVGSAMGLDEQITTNMPSSSGARKEALEALIALGYKAAEADRMIRSF
DAQDMTTEQIIRQALQRN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcgtcttaccggaattattatcgaaaaacagccgccggaattagtgctggat
gtaaatggggtgggctatgaagtctccgcccccatgtcgacgtttgtaaatttgccgtca
cttaatgaaaaagtgagtttatatacccatttagtcgtgcgcgaagatgcccaattgtta
tatggttttgcgactactcgcgaacgattattatttcgcagtttacttaaggtaaatggt
gtgggagcgaaactggcgctgacaattttatcggggagtgatgttgatagctttgcccga
agtgtgcaggaaggcgatgccgcaagtttgacgcgtttgccaggtgtcggtaaaaagaca
gcagatcgtcttattatagaaatgcgcgacagacttaaagaagtcggttctgcaatgggg
cttgatgaacaaattacgacgaatatgccgagcagcagcggggcacgaaaagaagcactg
gaagctttgattgctttagggtataaagccgccgaagcagacagaatgatccgtagtttt
gatgcgcaggatatgactaccgagcaaatcatcagacaggcgttacagcgtaactaa

DBGET integrated database retrieval system