KEGG   Methylophaga nitratireducenticrescens: Q7A_1351Help
Entry
Q7A_1351          CDS       T02055                                 

Definition
(GenBank) succinate--CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej00020  Citrate cycle (TCA cycle)
mej00640  Propanoate metabolism
mej00660  C5-Branched dibasic acid metabolism
mej01100  Metabolic pathways
mej01110  Biosynthesis of secondary metabolites
mej01120  Microbial metabolism in diverse environments
mej01130  Biosynthesis of antibiotics
mej01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Q7A_1351
   00640 Propanoate metabolism
    Q7A_1351
   00660 C5-Branched dibasic acid metabolism
    Q7A_1351
Enzymes [BR:mej01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Q7A_1351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Succ_CoA_lig ATP-grasp TLC
Motif
Other DBs
NCBI-ProteinID: AFI84181
UniProt: I1XIG2
Position
1352683..1353846
Genome map
AA seq 387 aa AA seqDB search
MNLHEYQAKQLFNQYGIATPKGQMIATADEVESAITAIGGERWVVKAQVHSGGRGKAGGV
RVEDNLDAVKDAVNAMLGSQLVTHQTTAEGLPVNKIWIETPSSIARELYLALLVDRVTQR
VVFMISAEGGMDIEEVAEKTPEAILNLYVDPAAGLQPYQCRQAGFFLQLTGAAFKQLQQL
MQNLYQLFCEKDISLLEINPLVVTESGDLLALDAKINVDDNALYRHTDLAELFDPSQENP
AEVIARDFGLNYIALDGNVACMVNGAGLAMATMDLIQKQGGEPANFLDVGGGTTADRVAE
AFKLILSDKKVKSILVNIFGGIVRCDLIAQGIMQAAKEVGLSLPVVVRLEGTNADLGRTL
LENSGMNLRVAQDLTEAAAMAVTAAGE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgcatgagtatcaggcaaaacaattgtttaaccaatatggcatcgcaacacct
aaaggacagatgatagctactgctgatgaagtggaatctgccattacagcaattggtggt
gaacgttgggtcgtaaaagcccaggtgcatagcggcggacgtggtaaggcgggcggggtg
cgcgttgaagataacctggatgcggtgaaggatgcggtaaatgcgatgctgggaagtcag
ctggtgacacaccagacgacggcagagggcttaccggtaaataaaatctggattgaaacc
ccatcatcaattgcccgtgaattatatctcgccttactggtcgaccgcgtcacgcaacgt
gttgtatttatgatttcagctgaaggcggaatggatattgaagaagtcgccgagaaaacg
ccggaagctattttaaatctctacgtcgatccagccgccggtctgcaaccctatcaatgt
cgtcaggcgggtttctttttgcagttaaccggtgcagccttcaagcagttacagcaactg
atgcaaaacctctatcagctgttttgtgaaaaagacatcagcctgttggaaattaacccg
ttagtggtgaccgaatccggagatttactggcattggatgccaaaatcaatgtcgatgat
aacgctttatatcgtcacacggatttggctgaattatttgatccaagccaggaaaatcca
gctgaagtgatcgcgcgtgattttggactgaattatattgctctggatggcaatgtggcc
tgtatggtcaatggtgccgggttggcaatggccaccatggatttgatacagaagcaggga
ggtgaaccggccaatttccttgatgttggtggtggtacgactgcagatcgcgttgctgaa
gcgttcaagttgattttatctgataaaaaagtgaaatccattctggtgaatatctttggc
ggaatcgtgcgctgtgacctaattgctcaaggcattatgcaggctgccaaggaagttggt
ttatcgttgccggtggtggttcgcctggaaggtaccaatgccgatttgggccgcacatta
ctggaaaacagtggaatgaatttacgcgtagcacaggatttaactgaagcagcagccatg
gctgtcactgcggcaggggagtaa

DBGET integrated database retrieval system