KEGG   Methylophaga nitratireducenticrescens: Q7A_1396Help
Entry
Q7A_1396          CDS       T02055                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Q7A_1396
   00052 Galactose metabolism
    Q7A_1396
   00500 Starch and sucrose metabolism
    Q7A_1396
   00520 Amino sugar and nucleotide sugar metabolism
    Q7A_1396
Enzymes [BR:mej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Q7A_1396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1400035..1400892)
Genome map
AA seq 285 aa AA seqDB search
MAVKSLIRKCLFPAAGYGTRFLPATKAMPKEMLPIVSKPLIQYGVEEAMEAGISQIGFIT
GRGKRAIADHFDTSFELEHQIKGTSKEKFLDDIRYLMDNCEFVFMRQREMLGLGHAILTG
EPMIGNEPFAVILADDLCAKPDEGGERALSQLVALYERYQCSIVAIEEVPADETHSYGVI
SGDEIAPGIYQIKDMVEKPKPEEAPSNLAIIGRYILTPEIFEYLRKTKPGTNGEVQITDA
LRLLAKDRLVLAVKFKGRRFDCGSVEGFVEATNYYYEHEHLNKLA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaaaagtcttataagaaaatgtttattccctgcggcaggttatggcacacga
tttcttcctgcaacaaaagcaatgcccaaagaaatgttaccaattgtcagtaaacctttg
attcaatatggtgttgaagaagcgatggaggcgggtatttcacaaattggttttattacc
ggccgcggtaaacgggccattgccgatcatttcgacaccagtttcgaactggaacatcaa
attaaaggtacctcaaaagaaaaatttctcgacgatattcgttatctgatggataactgt
gaatttgtatttatgcgccaacgggaaatgttaggtttgggtcatgccatcctgacaggc
gagccgatgattggcaatgagccttttgcggtcattctggctgacgatttatgcgccaaa
ccggatgaaggcggtgaacgtgctctgagtcaattggttgcattatatgaacgttatcag
tgcagcatcgtcgcgattgaggaagtccctgctgatgaaacccatagttatggtgtcatt
tccggtgatgaaatcgctccgggtatttatcaaataaaagacatggttgaaaaacccaaa
cctgaagaagcccccagcaatctggcaattatcggacgctatattctgacaccggagatt
tttgaatatctgcgaaaaaccaaacccggcaccaatggcgaggttcaaataaccgatgcc
ctgcgtttgctggcaaaggatcgactggttttagctgttaaatttaaaggtcgtcgtttt
gattgcggcagcgtcgaaggttttgttgaagcgacaaactattattacgaacatgagcat
ttgaataaattagcgtaa

DBGET integrated database retrieval system