KEGG   Methylophaga sp. JAM1: Q7A_1426Help
Entry
Q7A_1426          CDS       T02055                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mej  Methylophaga sp. JAM1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mej00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1432778..1434715
Genome map
AA seq 645 aa AA seqDB search
MCGIVGAIGFVDNFISEKIHLMNELQKHRGPDGEGVWEHKLTQKNQGVIFGHRRLAIIDL
SQDGHQPMIDVVSGNAITFNGEIYNYRSLRDELVAQGESFKTKTDTEVLLVAYRHWGESF
VGKLRGMFAFALWDASKDEVIFCRDRLGIKPLYYYEKQDQNRTLLFSSELRTLLKSGLVP
RKLNPESMQSYLWNGFVASKESTIIKDIKTLSPGFSMRVSASSGEIISKYKFWSLPKSSS
SPQSTVSRVSTVFEETMQLHMLSDVSLGIFLSGGVDSSAVAAVAKSQADTQVSTYNLSFD
EALFDEAKYARQVAQSLGTDHHEIKLTQSDFNQNFTAAFESIDQPTFDGINTFFISKAIK
DAGITVALAGTGGDELFGGYSSFREVPKITQVGNIINHVPECLANLTAGAWNKIMELKYG
SVPPQTRWGKLADLIRVKGNTIGAYQTSYSLFTSEFQNKLSAQKSENIKFGVDKALYATL
SEDIVNCSTLESISNLELNMFIEQRLMRDTDAASMATSLEVRVPLLDHVFIESVAGLSPE
TRYQPLGKKQVLRDLAARYINPDIFERPKSGFVLPLDVWCKSSMEEKISELFNDKDLCSS
IGLNSSLLYELLVAFKRNQAGIYWTRIWSIYILLAWCKKNQVSLY
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgtgggtgcaataggctttgtagataattttatctcagaaaaaattcat
ttaatgaatgaattacaaaagcaccggggaccagatggggaaggtgtttgggagcataag
cttacccaaaaaaatcaaggcgttatttttggtcatcggcgtttagctatcattgacttg
agtcaagacggacatcagccaatgattgatgtggtttctggaaacgctattacctttaat
ggtgaaatttataattatcggtctttaagagatgaacttgttgctcaaggtgagtccttt
aaaaccaaaacggatactgaagttcttttggttgcatatcgacactggggtgaaagcttt
gttggaaaattaagggggatgtttgcttttgcgctatgggatgccagtaaagatgaagtc
atattttgtcgtgataggctaggtataaagcctctctattattacgagaagcaagatcaa
aatagaacgctgttattttcttctgagttgagaacactgttaaaaagtggtcttgtgcct
agaaaattaaatccagaaagtatgcaaagttatctttggaatgggtttgttgcgtctaaa
gagtcaaccattatcaaggatataaaaacgctgtctcccgggttcagcatgagggtttct
gcttcttcaggtgaaattatttctaagtataaattttggagtctcccaaaaagttcctct
tcacctcagtcaacggttagtcgtgtttcaacggtttttgaagaaaccatgcaattgcat
atgctgagcgatgtttcacttggaatttttttatctggtggggttgattcaagtgcggtt
gcagcagttgctaagagccaggccgatacacaggtttcaacatataacctgtcttttgat
gaagcattatttgacgaagcaaagtatgcaaggcaagttgcgcagtcattaggcaccgac
catcacgaaattaaattaacccaatccgattttaatcagaactttacagcagcatttgag
agtattgatcaaccaacatttgatggaatcaatactttttttattagtaaggcaattaaa
gacgcaggaatcacggtcgctctggcaggaactggaggcgatgaattattcggtggttat
tccagttttagagaagtccccaagattacacaagtggggaacatcattaatcatgtacca
gaatgtttggctaatttaacagcaggtgcgtggaataaaattatggaattaaagtatggc
tcagtgccgccacagacaaggtggggaaagttggctgatttgattagagttaaaggcaat
acgataggggcttatcaaacttcttattcactatttaccagtgaatttcaaaataagctt
tcagctcaaaaatcagagaatattaagtttggggtagataaggctctatatgcgacttta
tctgaagacatcgttaattgttcaactttagaatcaatttctaatcttgagctaaacatg
tttattgaacagcgattgatgagggacacagatgctgcgagtatggcgacatcacttgaa
gtaagagtacctctactagaccacgtattcattgagtcagttgcaggtttatctccagaa
acgagataccaacctcttggaaaaaaacaagtgttaagagatcttgctgctcgatatata
aatcctgatatctttgagcgacccaaatcaggctttgtattacctttggatgtttggtgt
aaaagctcaatggaagagaaaatttcagaattatttaatgataaggatttgtgttcatca
atagggttaaattcttcattgctctatgagctactagtagcatttaaaagaaatcaagct
ggtatatattggactagaatctggtccatttatattttgttggcatggtgtaaaaagaac
caagtttctttgtactaa

DBGET integrated database retrieval system