KEGG   Methylophaga nitratireducenticrescens: Q7A_1484Help
Entry
Q7A_1484          CDS       T02055                                 

Definition
delta-9 fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Q7A_1484
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Q7A_1484
Enzymes [BR:mej01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Q7A_1484
Lipid biosynthesis proteins [BR:mej01004]
 Desaturase
  First
   Q7A_1484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1493984..1494916
Genome map
AA seq 310 aa AA seqDB search
MKFIRHWFDNGEPRVSSAEYDKSDTGVDWLRVIPFIVMHLACLTVLFVGVSTVAVVTAIT
LYLLRMFAITAFYHRYFSHKAFRTSRKIQFIFALIGASATQRGPLWWAAHHRQHHRYADQ
PADPHSPKQGFFWSHMGWFLSGKHYQADYNLVQDWKRFVELRWLDRFDLIAPVLLALTLF
IFGVLLEKFAPELKTSGWQMLVWGYFISTVVLLHVTLLINSMAHRIGKKRYTTNDESRNN
FLLALLTLGEGWHNNHHHYPASARQGFYWWEVDVSYYLLKLMQKSGLIWDVRTVPLHKRD
SKKIIPEADL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttattcgacattggtttgataatggtgaaccccgggtttcttctgctgagtat
gacaagtcagatactggtgttgactggctcagagtcattccttttatcgtgatgcatttg
gcttgtctgaccgttttatttgtgggcgtttccactgttgctgttgttacggcaataaca
ttatatttattgagaatgtttgccataacagcattttatcatcgttatttttcacataaa
gcctttagaacttcgcgaaaaatccaatttatctttgccttgattggcgccagtgcaaca
caacgaggccctttatggtgggcggcacaccatcgtcagcatcatcgctatgcagatcag
cctgccgatccccattcccccaagcagggctttttttggagtcatatgggctggtttctt
tcaggaaaacattatcaggctgattataatctggttcaagactggaaaagatttgtcgag
ctacgttggctggatcggtttgatttaattgctccggttctattggctttaaccttattt
atctttggtgtattactggaaaagtttgcacccgaattgaaaaccagcggttggcaaatg
ttagtgtggggctatttcatttcaacggtagtgttattacacgtcacgttgttgataaat
tccatggcgcaccgaattggtaaaaaacgatacacaacaaacgatgaaagtcgtaataat
tttctgttggcattacttactctaggagaaggttggcacaataatcaccatcattacccg
gcttccgccagacaaggcttttattggtgggaagtcgatgtaagttactacttattaaag
ctaatgcaaaaatcagggctcatctgggacgttcgcacggtgccacttcataaacgtgat
tccaagaaaatcattccggaggctgatttatga

DBGET integrated database retrieval system