KEGG   Methylophaga sp. JAM1: Q7A_1484Help
Entry
Q7A_1484          CDS       T02055                                 

Definition
delta-9 fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mej  Methylophaga sp. JAM1
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mej01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mej01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1493984..1494916
Genome map
AA seq 310 aa AA seqDB search
MKFIRHWFDNGEPRVSSAEYDKSDTGVDWLRVIPFIVMHLACLTVLFVGVSTVAVVTAIT
LYLLRMFAITAFYHRYFSHKAFRTSRKIQFIFALIGASATQRGPLWWAAHHRQHHRYADQ
PADPHSPKQGFFWSHMGWFLSGKHYQADYNLVQDWKRFVELRWLDRFDLIAPVLLALTLF
IFGVLLEKFAPELKTSGWQMLVWGYFISTVVLLHVTLLINSMAHRIGKKRYTTNDESRNN
FLLALLTLGEGWHNNHHHYPASARQGFYWWEVDVSYYLLKLMQKSGLIWDVRTVPLHKRD
SKKIIPEADL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttattcgacattggtttgataatggtgaaccccgggtttcttctgctgagtat
gacaagtcagatactggtgttgactggctcagagtcattccttttatcgtgatgcatttg
gcttgtctgaccgttttatttgtgggcgtttccactgttgctgttgttacggcaataaca
ttatatttattgagaatgtttgccataacagcattttatcatcgttatttttcacataaa
gcctttagaacttcgcgaaaaatccaatttatctttgccttgattggcgccagtgcaaca
caacgaggccctttatggtgggcggcacaccatcgtcagcatcatcgctatgcagatcag
cctgccgatccccattcccccaagcagggctttttttggagtcatatgggctggtttctt
tcaggaaaacattatcaggctgattataatctggttcaagactggaaaagatttgtcgag
ctacgttggctggatcggtttgatttaattgctccggttctattggctttaaccttattt
atctttggtgtattactggaaaagtttgcacccgaattgaaaaccagcggttggcaaatg
ttagtgtggggctatttcatttcaacggtagtgttattacacgtcacgttgttgataaat
tccatggcgcaccgaattggtaaaaaacgatacacaacaaacgatgaaagtcgtaataat
tttctgttggcattacttactctaggagaaggttggcacaataatcaccatcattacccg
gcttccgccagacaaggcttttattggtgggaagtcgatgtaagttactacttattaaag
ctaatgcaaaaatcagggctcatctgggacgttcgcacggtgccacttcataaacgtgat
tccaagaaaatcattccggaggctgatttatga

DBGET integrated database retrieval system