KEGG   Methylophaga nitratireducenticrescens: Q7A_1603Help
Entry
Q7A_1603          CDS       T02055                                 

Definition
Agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Q7A_1603
Enzymes [BR:mej01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Q7A_1603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1617832..1618716
Genome map
AA seq 294 aa AA seqDB search
MNTELNEEFPIFLGSEIDQADPKQAMFHVLPVPYEKTVSYGGGTNKGPSTILNASWQLEK
WDGKSNPCDLGIYTCPPVDCSVSSQQVIDNIANATAEIIRNGGIPVVLGGEHTVTYGVIK
GLKDAGIEDFGIVQIDAHADLRHAYEGDILSHASVMKRAVDMGIPLYQLGIRAFCEEEMQ
VREEFGVYYQDADELVPNNINSITLPDDFPQKVFFTVDIDGMDPSVFPSTGTPVPGGLSW
YQTLNLFESVAKQREIIGFDVMEFAPIEGFHAYDFAASMLTYKLMGITARSRQS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaacacagaattgaacgaagaatttccgattttcctgggctctgaaattgatcaggcc
gatcccaaacaggccatgtttcatgttttacctgtaccctatgaaaaaacggtgtcttat
ggtggcggcaccaataaagggccctcaacgattttgaatgcatcctggcagctggaaaaa
tgggatggtaaaagtaatccatgtgatttgggtatctatacctgcccgccagtcgattgc
agcgtcagctcacaacaggtgattgataatatagccaatgcaaccgctgaaattattcgc
aatggtggtatcccagtcgtattaggcggcgaacataccgtgacctatggcgtcatcaaa
ggattgaaagatgccggtattgaagacttcggtattgtgcagattgatgcccatgccgat
ctgcgtcatgcctatgaaggcgatattctgagtcatgcatcggtaatgaaacgtgcggtt
gatatgggtattccattatatcagctgggaattcgtgcgttttgtgaagaagaaatgcag
gtacgtgaagagtttggtgtgtattaccaggatgccgatgaactggtccccaacaatatc
aacagtattaccttgcccgatgattttccgcagaaagtgttttttacggtggatattgat
ggcatggatcccagtgtgtttccttcaacaggcacaccagtaccgggtggactgagctgg
tatcagacattgaacctgtttgaatccgttgccaaacaacgtgaaatcatcggctttgat
gtaatggaatttgcaccgattgaaggctttcatgcatatgacttcgcggcatcaatgctg
acctacaagttgatggggatcactgctcgtagccgccaaagctga

DBGET integrated database retrieval system