KEGG   Methylophaga nitratireducenticrescens: Q7A_1672Help
Entry
Q7A_1672          CDS       T02055                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mej01100  Metabolic pathways
mej01110  Biosynthesis of secondary metabolites
mej01130  Biosynthesis of antibiotics
mej01230  Biosynthesis of amino acids
Module
mej_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Q7A_1672 (trpC)
Enzymes [BR:mej01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Q7A_1672 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AFI84494
UniProt: I1XJC5
Position
complement(1690559..1691356)
Genome map
AA seq 265 aa AA seqDB search
MTETPDILKKILQRKQQEIAERSKRLPINLLQQLAENAEPVRGFVEALERKLAAGQSAVI
AEVKKASPSKGVLREDFRPAEIAMSYENGGAACLSVLTDQDFFQGHEDYLKQARTVCKLP
VIRKDFIIAPYQVFEARAIGADCILLIVAALDDDQLEQLSQLAIQLDMDVLVEVHNEEEL
HRALVLNLPLIGINNRDLHTFETSLETTIKLLNFIPDEMIVITESGILGKEDVTFMREHG
VNGFLVGEAFMRADEPGEALANLFN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaacacccgatattctgaaaaaaattctgcaacgtaaacaacaggaaattgcc
gagcgcagtaaacgtttgcccattaacctgttacaacaattggctgaaaatgctgaaccg
gtacgcggttttgttgaggcccttgaacgtaaattggctgccgggcaaagtgccgttatt
gctgaagttaaaaaagcctcacccagcaaaggtgtgctgcgagaggattttcgtcctgct
gaaattgccatgtcttatgaaaacggtggcgcggcctgtttatcggtattgaccgatcag
gattttttccaaggccatgaagattatctgaaacaggcgcgtacggtctgtaagctaccg
gtcattcgtaaagattttattatcgctccctatcaggtttttgaagccagagcgatcggt
gccgattgcatactgctgattgttgccgcgttggatgatgatcaactggaacagttaagt
cagttagcgattcagctggatatggatgtgctggttgaagtgcataacgaagaagagttg
catcgtgcattggtattgaatctgcctctgataggcatcaataaccgcgatttacatact
tttgaaacgtcgctggaaaccactatcaagttacttaattttattcccgatgaaatgata
gtgatcaccgaaagcggtatccttggtaaggaagatgtcactttcatgcgtgagcacggt
gtgaatggtttcctggttggcgaggcctttatgcgggcagatgaaccaggtgaggcgtta
gccaacctttttaattga

DBGET integrated database retrieval system