KEGG   Methylophaga nitratireducenticrescens: Q7A_1749Help
Entry
Q7A_1749          CDS       T02055                                 

Definition
Arylesterase precursor (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Q7A_1749
Enzymes [BR:mej01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Q7A_1749
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Q7A_1749
Lipid biosynthesis proteins [BR:mej01004]
 Fatty acid synthase
  Component type
   Q7A_1749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1760530..1761168)
Genome map
AA seq 212 aa AA seqDB search
MKTLLPTQTLFIWLFLVLVSFQSQAAEPQRKNLLIVGDSLSAAYGIDSDAAWVELLKERL
EQETPETWNVANASISGETTDGGLRRLPDLLDNHDPAIVVIELGGNDGLRGFPPDVIRTN
LAKMIQLSQQHGAEVLLVGIEIPPNYGQPYTTAFANVFSSLAEEYNLAFLPFFLADVYDG
EAMMQADGIHPTAKAQPQLLDNIWTELLALLE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccttattacctacacaaacattgtttatctggctgtttttggttctagtcagt
ttccagtcacaagctgctgaaccccagcgaaaaaacctgttaattgttggcgacagtctc
agtgcagcctatggcatcgacagtgatgccgcctgggtcgagttactcaaagagcgcctt
gaacaggaaacacccgaaacctggaatgtagccaatgccagtatcagtggcgaaacaacc
gacggtggtttacgcagattaccggatttgctggacaatcatgatcccgctatcgttgtg
attgagttgggcggtaatgacgggttacgcggtttcccacccgatgtcattcgaactaat
ctggccaaaatgattcagttatcccaacagcatggtgccgaagtattattggtaggcatc
gaaattccacctaattatggtcaaccttataccacagcgtttgccaatgttttttccagt
cttgcagaagaatataatctcgcattcctgccctttttccttgctgatgtatatgatggc
gaggccatgatgcaggctgatggaatccatcctacggcaaaagctcagccacagttactc
gacaatatctggaccgaattactggcattacttgaatag

DBGET integrated database retrieval system