KEGG   Methylophaga nitratireducenticrescens: Q7A_1891Help
Entry
Q7A_1891          CDS       T02055                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej00010  Glycolysis / Gluconeogenesis
mej00620  Pyruvate metabolism
mej00640  Propanoate metabolism
mej00680  Methane metabolism
mej01100  Metabolic pathways
mej01110  Biosynthesis of secondary metabolites
mej01120  Microbial metabolism in diverse environments
mej01130  Biosynthesis of antibiotics
mej01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7A_1891 (acs)
   00620 Pyruvate metabolism
    Q7A_1891 (acs)
   00640 Propanoate metabolism
    Q7A_1891 (acs)
  Energy metabolism
   00680 Methane metabolism
    Q7A_1891 (acs)
Enzymes [BR:mej01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Q7A_1891 (acs)
Lipid biosynthesis proteins [BR:mej01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Q7A_1891 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF1967
Motif
Other DBs
NCBI-ProteinID: AFI84708
UniProt: I1XJY9
Position
complement(1927183..1929144)
Genome map
AA seq 653 aa AA seqDB search
MAQNNIESTLHENRHFPPSESFCKNSALNHKKLDALYVKASEDYEAFWGDLAKQELDWIK
PFSKTLDDSNAPFYKWFADGELNVSYNCLDRQLKDNANKTAIIFEGEPGDIQHITYQVLY
EKVCVFANALKKQGIKKGDRVIIYMPMVTEAVVAMQACARIGAIHSVVFGGFSAEALKDR
VEDTQAKLVITADGGHRGGKIIPLKNTADQALSKGCKSVETVIVFQRCNNDINMQDGRDI
WWHDAEQEQSAECEPEPMNASDPLFLLYTSGSTGKPKGIQHSSAGYLLNAINTMRWVFDI
QEKDVFWCTADVGWVTGHTYVAYGPLAVGATMIIYEGVPTVPDAGRFWDVCARHHVTIFY
TAPTAIRALMKAGDEIPQRYDLSHLRLLGTVGEPINPEAWMWYHRVIGQERCPIVDTWWQ
TETGAHMIAPVPAVTVTKPGSCTRALPGIDAAVVNEQGEALGPNQGGFLVIRKPWPAMIQ
TIWGDDQRYKDTYWPYFDGKYYLAGDSARIDEEGYFWIMGRIDDVLNVSGHRLGTMEIES
ALVAHESVAEAAVVGKPHEVKGESVFAYVVLKGERPEGGVDEDMTNELRAWVAEQIGPIA
KPDEIRYSDNLPKTRSGKIMRRLLRAIAKGEEITQDTSTLENEGILLQLQGKA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggctcagaataatattgaatcaactcttcatgaaaatcggcatttccctccgagtgaa
agcttttgtaaaaattctgcgttaaatcataaaaagcttgatgcactttatgttaaagca
tcagaggattatgaggcattttggggtgatttggcgaaacaggaactcgattggattaag
cctttcagtaaaacattggatgacagcaatgcccctttttataaatggtttgctgacggt
gaattgaatgtttcatataactgccttgatagacaattaaaagataacgcaaacaagact
gccattatttttgaaggtgaacccggcgatatccaacacattacttatcaagtgctttac
gagaaagtctgcgtgtttgctaatgcgttaaaaaaacaaggtattaaaaaaggtgatcgc
gtcattatttatatgccgatggttactgaagccgtagtcgcaatgcaggcatgtgcgcga
attggtgctatccattcagtggtctttggtggtttttcagctgaagcattgaaagaccgc
gttgaagatacacaggctaaactggtcattacagccgatggcggacatcgtggtggcaaa
attattccgctaaaaaatactgctgatcaggcattgagcaaaggctgcaagagtgttgaa
accgttatcgtttttcaacgttgtaataatgatataaacatgcaggatggccgggatatc
tggtggcatgatgctgaacaggagcaatcagcagaatgtgaacccgaaccaatgaatgct
tcggatccgctctttttactctacacatctggctcgactggtaaaccaaaaggtattcaa
cattcatcagccggttaccttttgaatgccattaacaccatgcgctgggtgtttgatatt
caggaaaaggatgttttctggtgtactgcagatgttggctgggttaccggtcatacttat
gttgcttatgggcctttggcggtcggcgcgacaatgatcatttatgaaggtgtgccaact
gtgccggatgctggacgtttttgggatgtctgtgcacgtcatcatgtcactattttctat
accgctccaacagcgattcgtgccttgatgaaagcaggcgatgaaattccacagcgctat
gatctctcccatctgcgtttattgggcacagtcggtgagccaatcaatccagaagcctgg
atgtggtatcacagggttattggtcaggaacgttgtccgattgtagatacctggtggcag
acagaaactggagctcatatgattgcgccagttcccgccgttacagtcaccaaaccaggt
tcatgcactcgtgccctgcccggtattgatgcggcagtggtcaatgaacaaggagaagcg
cttggtcccaatcaaggcggttttctggtgattcgcaaaccctggccggccatgattcaa
actatctggggagatgatcaacgttataaagatacttattggccctatttcgatggcaaa
tactatttggcgggtgacagtgctcgtattgatgaggaaggatacttctggatcatgggg
cgtattgatgatgtgctaaatgtttcaggtcaccgtcttggtaccatggaaattgaatcg
gcattagttgctcatgaatctgttgctgaggctgcagtagtcggtaaaccgcatgaagtt
aaaggtgagtcggtatttgcttatgtcgttttaaaaggcgaacgtcctgaaggcggcgtt
gatgaagacatgactaatgaattaagagcatgggtagccgaacaaatcggacctatcgcc
aaaccagatgaaattcgttattccgataatctccccaaaacccgcagcggtaaaataatg
cgtcgtttactacgagccattgccaagggtgaagagatcacccaagacacttcaacgctg
gaaaacgaaggcattttattgcagttgcaaggtaaggcttga

DBGET integrated database retrieval system