KEGG   Methylophaga nitratireducenticrescens: Q7A_2067Help
Entry
Q7A_2067          CDS       T02055                                 

Definition
(GenBank) D-hexose-6-phosphate mutarotase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej00010  Glycolysis / Gluconeogenesis
mej01100  Metabolic pathways
mej01110  Biosynthesis of secondary metabolites
mej01120  Microbial metabolism in diverse environments
mej01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7A_2067
Enzymes [BR:mej01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Q7A_2067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFI84881
UniProt: I1XKG2
Position
complement(2120496..2121404)
Genome map
AA seq 302 aa AA seqDB search
MQTIEQLKQQFAIADRLDFSMGPSECVMININTPHAKARITTQGAQVLSYRSADALHDLL
FLSRLSRYGDRRAIRGGVPVCWPWFGVDPSGKGRPAHGFARNRVWDLIDVQQTENDGIKL
ILSLAPDPRDEPLWHCAYSLKMEIVIGEQLTLSLTTENLDKESFVISQALHTYFAVGNIE
KTQVRGLSNHHYLDKVENFREKLQAGEIVFDGETDRVYLNSPDKLFIEDSDWARRIVVES
SGSNTTIVWNPWDRVSTLKDMTDDSYQYFVCVETANAANNSISLAPGESHTISAGYRIMP
LG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactatagaacaactaaaacaacaatttgctattgctgatcgcctggatttttct
atgggcccttcagaatgtgtgatgataaatatcaatacgcctcatgccaaggcgcgaata
acaacacagggtgcgcaggtattatcttaccgctctgcagatgcattacatgatctattg
tttttgagtcgattgagccgttatggtgatcgacgggcaattcgtggaggcgtccctgtc
tgttggccatggtttggtgttgatcccagtggtaagggccgtcctgctcatggttttgca
cgtaaccgtgtttgggatctgattgatgtgcaacagactgaaaatgatggcattaaattg
attctgtcattagcaccggatcctagggacgaaccgctttggcattgtgcttatagtttg
aaaatggaaatcgtgattggagagcagttgacactctcactgactaccgaaaacctcgat
aaagaaagttttgttatctcgcaggcattgcatacgtattttgcggtgggaaatatcgaa
aaaactcaggtgagggggttgagcaatcatcattatctcgacaaggtagaaaatttccgt
gagaaacttcaggctggtgagatcgtttttgacggggaaacagacagggtatatctgaat
agtcctgacaagctgtttattgaggattctgactgggcacgacgcattgtggtggaaagt
tcaggttctaataccacaatagtatggaatccgtgggatagggtgtcgacattaaaagat
atgactgatgactcgtatcagtactttgtctgtgttgaaactgccaatgcagccaataac
agtatcagtttagcaccgggcgaatcgcatacgatttcagctggttacagaatcatgcca
ttggggtag

DBGET integrated database retrieval system