KEGG   Methylophaga nitratireducenticrescens: Q7A_2080Help
Entry
Q7A_2080          CDS       T02055                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mej  Methylophaga nitratireducenticrescens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2133024..2134061)
Genome map
AA seq 345 aa AA seqDB search
MKHSEHEERTAEWMRLALSKMKQYEIPPTPVNYALWFEYVSGTNLALVEAVDSEIELTGK
ITEQQVRLLHEQFFDDDKDRAAMFEMRQELARLLKQTLNYIYTGVTTTDRSNSHLQSMLT
RLQPDLNRQQLHTLIEEVLIETRLAVSSGELLNEQLNGAMVEVAALKKELSDSRRESITD
SLTGLANRKHFDELISEMIRDADQNGIDVSVIFCDVDMFSVINEKHGQLVGDQVLRVIAE
LMRKSLKGRDLVARYGGEEFAVILPNTSMQNARQLAESIRQDIAGKRIQRKDTREPLGTI
TMSFGVARYVPGEGVDSFLQRVDRAVYLAKRSGRNNVSDAPPPII
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatagtgaacatgaagagcgaactgctgaatggatgcgactagcgctctcaaaa
atgaaacaatatgagattcctcccacaccagtaaattatgcgctttggtttgagtacgtt
tccggtacaaatctagcgttggtagaagccgtagacagtgaaattgaactaacagggaaa
ataactgaacagcaagtacgcttgttgcatgaacaattctttgatgatgataaagatagg
gctgcgatgtttgaaatgcgtcaagagcttgcccgtcttctcaaacagactttgaactat
atttataccggtgtgactacaaccgatcgtagtaacagccatttacaaagtatgctgacg
cgcttgcaaccagatttaaatcgtcagcaattgcatacactcatcgaagaggtgcttatt
gaaacccgactggcagtttcgtcgggtgaattactcaacgagcagttaaatggtgcaatg
gtagaagttgctgcactgaaaaaagaactaagcgattcccgtcgagaatcaatcacagat
agtttgactggattagccaatcgtaaacattttgatgagttgatcagcgagatgatccgt
gatgctgatcagaacggcatcgatgtgtcagtgattttttgtgatgtggatatgttcagt
gttatcaatgaaaaacatgggcagttagtaggtgatcaggtcttaagagtgattgctgag
ttgatgaggaaatcgctgaaaggacgtgatttagtcgctcgttatggaggtgaagagttt
gctgttattttacccaacaccagcatgcaaaacgcccgtcaacttgctgaaagtattcga
caggatattgccgggaaacggattcaacgcaaggatacccgtgaaccacttggcactatc
accatgtcatttggtgtggcgcgttatgttcctggtgaaggtgttgatagtttcctacaa
cgtgttgatcgagcggtttatctggcaaaacgcagtggacgcaacaatgtctcagacgca
ccgccgccaattatctga

DBGET integrated database retrieval system