KEGG   Methylophaga nitratireducenticrescens: Q7A_2080Help
Entry
Q7A_2080          CDS       T02055                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
mej  Methylophaga nitratireducenticrescens
Brite
Enzymes [BR:mej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Q7A_2080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2133023..2134060)
Genome map
AA seq 345 aa AA seqDB search
MKHSEHEERTAEWMRLALSKMKQYEIPPTPVNYALWFEYVSGTNLALVEAVDSEIELTGK
ITEQQVRLLHEQFFDDDKDRAAMFEMRQELARLLKQTLNYIYTGVTTTDRSNSHLQSMLT
RLQPDLNRQQLHTLIEEVLIETRLAVSSGELLNEQLNGAMVEVAALKKELSDSRRESITD
SLTGLANRKHFDELISEMIRDADQNGIDVSVIFCDVDMFSVINEKHGQLVGDQVLRVIAE
LMRKSLKGRDLVARYGGEEFAVILPNTSMQNARQLAESIRQDIAGKRIQRKDTREPLGTI
TMSFGVARYVPGEGVDSFLQRVDRAVYLAKRSGRNNVSDAPPPII
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatagtgaacatgaagagcgaactgctgaatggatgcgactagcgctctcaaaa
atgaaacaatatgagattcctcccacaccagtaaattatgcgctttggtttgagtacgtt
tccggtacaaatctagcgttggtagaagccgtagacagtgaaattgaactaacagggaaa
ataactgaacagcaagtacgcttgttgcatgaacaattctttgatgatgataaagatagg
gctgcgatgtttgaaatgcgtcaagagcttgcccgtcttctcaaacagactttgaactat
atttataccggtgtgactacaaccgatcgtagtaacagccatttacaaagtatgctgacg
cgcttgcaaccagatttaaatcgtcagcaattgcatacactcatcgaagaggtgcttatt
gaaacccgactggcagtttcgtcgggtgaattactcaacgagcagttaaatggtgcaatg
gtagaagttgctgcactgaaaaaagaactaagcgattcccgtcgagaatcaatcacagat
agtttgactggattagccaatcgtaaacattttgatgagttgatcagcgagatgatccgt
gatgctgatcagaacggcatcgatgtgtcagtgattttttgtgatgtggatatgttcagt
gttatcaatgaaaaacatgggcagttagtaggtgatcaggtcttaagagtgattgctgag
ttgatgaggaaatcgctgaaaggacgtgatttagtcgctcgttatggaggtgaagagttt
gctgttattttacccaacaccagcatgcaaaacgcccgtcaacttgctgaaagtattcga
caggatattgccgggaaacggattcaacgcaaggatacccgtgaaccacttggcactatc
accatgtcatttggtgtggcgcgttatgttcctggtgaaggtgttgatagtttcctacaa
cgtgttgatcgagcggtttatctggcaaaacgcagtggacgcaacaatgtctcagacgca
ccgccgccaattatctga

DBGET integrated database retrieval system