KEGG   Methylophaga nitratireducenticrescens: Q7A_2122Help
Entry
Q7A_2122          CDS       T02055                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej00480  Glutathione metabolism
mej00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Q7A_2122
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Q7A_2122
Enzymes [BR:mej01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Q7A_2122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin Defensin_propep Thioredoxin DUF3986
Motif
Other DBs
NCBI-ProteinID: AFI84936
UniProt: I1XKL7
Position
complement(2180665..2181201)
Genome map
AA seq 178 aa AA seqDB search
MRTLVLLLSSLMLSFSVQAAESCPEFLDYELPKLHSNETVNLCKVANDKPLLVVNTASHC
GYTRQFEGLEALHQKYKESGLMVVGFASNDFNQEAKEEAEVERVCRENFGVTFTMIAPSF
VTGQKANPVFQEINRQSEQPGWNFTKYLISKEGKVVATFPSKVQPSDKKLIDAIASLL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcgtactctcgtgctgttactatcaagtttaatgctatctttttcagttcaggcagca
gaatcctgtcctgaatttctcgattatgaactgcccaaactgcattccaatgaaacagta
aatctatgcaaagttgccaatgacaagccattactcgtcgttaacaccgccagtcactgc
ggctacactcgccagtttgaaggacttgaagccttgcatcagaaatataaagaaagcggt
ttgatggttgtcggctttgccagtaatgattttaaccaggaagctaaagaagaagcagag
gttgaacgggtttgccgggaaaactttggtgtaaccttcaccatgattgcgccaagtttt
gttaccgggcagaaagctaacccggtgtttcaggaaatcaatcgccagagtgaacagcct
ggctggaactttactaaatatttgattagcaaagaggggaaagtcgtcgccacttttcca
agtaaagttcagcccagcgataaaaagctgatcgatgcgatagcttctttgttgtaa

DBGET integrated database retrieval system