KEGG   Methylophaga sp. JAM1: Q7A_2193Help
Entry
Q7A_2193          CDS       T02055                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mej  Methylophaga sp. JAM1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mej01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mej00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mej00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2255007..2255834)
Genome map
AA seq 275 aa AA seqDB search
MSRIKECFKNLQADGQTALIPYVTAGDPEPWVTVPLLHALVDAGADIIELGVPFSDPMSD
GPVIQKACERALKNDVTLDSILDMVKQFREKNKHTPIVLMGYANPLEAMGYEKFAKKAQA
VGVDGVLTVDMPPEESDEFLRLMDVHDIDTIFLVAPTTSAQRMQKIAQYAKGFIYYVSIK
GVTGAAALEINEVTAKLEEIRKYTSLPVGVGFGIRDGRSAAAVAEVADAVVVGSTLVRCI
EEHSNRPQELPAAVASLLAEMRHAINARDLASVSA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtattaaagaatgttttaaaaatcttcaggcagatgggcaaactgctttaatc
ccttatgtgacggcaggtgatcctgaaccatgggtaaccgtaccactgttacatgctttg
gtggatgccggtgccgatattatcgaactgggtgtgcctttctctgaccccatgtcggat
ggccctgtgatccaaaaagcctgtgaacgggcattgaaaaatgatgtcacgctggattca
attctggatatggtgaaacagttcagagagaaaaataagcatacgccaatcgtgctgatg
ggatatgccaatccccttgaagcaatgggttatgaaaagttcgccaaaaaagcacaggct
gtcggggtggatggggtgttgactgttgatatgcctccggaagagtctgatgaattcctg
cgcctgatggacgtacatgatattgatacgattttcctggttgcgccaacaacatcggca
cagcgtatgcagaaaattgcccaatatgccaaaggctttatttattatgtttcgatcaaa
ggtgtgacgggtgctgccgcattggaaattaatgaagtaaccgccaaacttgaagaaatt
cgtaaatacacttcgttaccggttggtgtggggtttggtatcagagatggccgctcagcc
gcagctgtcgcggaagtggctgatgctgtagtggtgggcagtactttggtacgttgcata
gaagaacattccaatcgcccacaggaattacccgcagcagtagcaagtctgttagctgaa
atgcgtcatgcaattaatgcgcgtgatttagccagcgtctcggcctaa

DBGET integrated database retrieval system