KEGG   Methylophaga sp. JAM1: Q7A_2223Help
Entry
Q7A_2223          CDS       T02055                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
mej  Methylophaga sp. JAM1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mej00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mej00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:mej03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:mej03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mej03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2285689..2286123
Genome map
AA seq 144 aa AA seqDB search
MTKVSFYILGSTDPLDRQQFACRLAEKAYLQGHQVFIHTEDQDQSEAMDKALWAFRPDSF
VPHQVLATDNKIEAPVLISHENIAPPKLMDVLINLNPVQPLFFSQFERLAEIINGDEAIK
KQGRVRYQFYKDRGYHLDTHQINN
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagtcagtttttatattttaggttcaaccgatccgcttgaccggcagcaattt
gcctgccggctggcggaaaaagcttatctacagggtcatcaggtgtttattcatactgag
gatcaggaccagagtgaagcgatggataaggctttatgggcttttcggccagacagtttt
gtcccgcatcaggtcttagcgacagataataaaatcgaagcgccagttttgattagccat
gaaaatatagcgccaccaaaactgatggacgtattaatcaatttaaacccggttcaacca
ttatttttcagtcagtttgaacggctggccgaaattattaatggcgatgaagcaatcaaa
aaacagggacgcgttcgctatcagttttacaaggatcgtggctatcatctcgatacgcat
caaataaacaattaa

DBGET integrated database retrieval system