KEGG   Methylophaga nitratireducenticrescens: Q7A_2418Help
Entry
Q7A_2418          CDS       T02055                                 

Definition
(GenBank) phosphomannomutase/phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej00010  Glycolysis / Gluconeogenesis
mej00030  Pentose phosphate pathway
mej00051  Fructose and mannose metabolism
mej00052  Galactose metabolism
mej00230  Purine metabolism
mej00500  Starch and sucrose metabolism
mej00520  Amino sugar and nucleotide sugar metabolism
mej00521  Streptomycin biosynthesis
mej01100  Metabolic pathways
mej01110  Biosynthesis of secondary metabolites
mej01120  Microbial metabolism in diverse environments
mej01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7A_2418
   00030 Pentose phosphate pathway
    Q7A_2418
   00051 Fructose and mannose metabolism
    Q7A_2418
   00052 Galactose metabolism
    Q7A_2418
   00500 Starch and sucrose metabolism
    Q7A_2418
   00520 Amino sugar and nucleotide sugar metabolism
    Q7A_2418
  Nucleotide metabolism
   00230 Purine metabolism
    Q7A_2418
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Q7A_2418
Enzymes [BR:mej01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Q7A_2418
    5.4.2.8  phosphomannomutase
     Q7A_2418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: AFI85218
UniProt: I1XLE9
Position
complement(3014355..3016256)
Genome map
AA seq 633 aa AA seqDB search
MQPNTPQAHILLTKRLEASRFLVLTLQTTELENKLRERYLSIGSGSLALQQGAQNWLTLF
QQGDNTVQDSSPIYTQTLSGAYWRLAFWPADRVAKSAAWPALIILIIIVCILCWLVATRF
STLRPKKQVQTGARPRPVEYVENEVNIDHTPTPTAIRVATPKVSKTESVDRVRPVDIKPV
IFKTYDIRGIVGTQLSEPIMRVLGLAIGTEAQHQEQTRIIVGRDGRLSSESFSDALIEGL
LASGCDVTDIGAVPTPLVYFASQHMRTHCGVVVTGSHNPQGYNGLKIVINDKTLSGEAIQ
GIYQRIQQSRLYSGEGQLRQADVIGSYIEQVKQVVPLSRPLKVGVDCGNGIAGKVVPKLL
TALGCDVHELFCNVDGHFPNHHPNPAQPQNMQDISKLVRDKHLDIGLAFDGDGDRLGVVN
GEGEIIWPDRLLMLFASDILQRHKGSTIVYDVKSTGLLEQVITKAGGKAMMCPSGHSLIR
AEMLKHDAKLAGELSGHIFFADNWYGFDDALFAACRLLALIADDPQRRGATEIFAAQPQR
FNTPEILIDLDTAECRRFMTQFTQNAQFDGAEVITIDGVRVNFDKGWGLVRASNTVPGLT
LRFEAETEEDLEQIKQQFIQQMLQVKPNLSLNF
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccaataccccacaagcgcatattttgttgaccaaaaggctggaggcttcacgc
tttctggttttaacattacaaactactgaattggaaaataaactcagagagcgctattta
tcaattggttcaggaagtctggcgttacagcaaggcgcccaaaactggttaactctgttc
cagcaaggtgataatacagtgcaggactccagccctatttatactcagacattatcgggg
gcttactggcgactggccttctggcctgctgatcgggttgctaaatccgcagcctggcca
gcattgatcatactgatcatcattgtgtgcattctatgttggttagtggccacgagattt
agtacgttaagaccgaaaaaacaagttcaaaccggagcacgaccacgaccggtggaatat
gtcgaaaatgaagtgaacattgatcatacgccaacccccaccgctattcgtgtcgcaacg
ccaaaagttagcaaaactgagtcagttgaccgagttcgtccagtggatattaaacctgtt
attttcaaaacctatgatattcgtggcattgtcggtactcaattaagtgaaccgattatg
cgggtattgggactcgcgataggtactgaggctcagcatcaggaacaaactcggattatc
gtcggtcgggatgggcggctttccagtgaaagcttcagcgatgccttgattgagggactt
ttggccagtggttgtgatgtcactgacattggtgcagtgccgaccccactggtatatttt
gcctcccagcatatgcgaacacattgtggggtcgtggtgacaggcagtcataatccacaa
ggctataatggcttaaaaattgtgattaatgataaaacgctctctggagaagctatccaa
ggtatttatcagcgcatccagcagtctcgtctatatagtggtgaaggtcagttgcggcag
gccgatgttattggtagctatattgaacaagtaaagcaggtcgttcctttatctcgtcca
ctaaaagtgggagtggattgtggaaatggaattgccggtaaagtggtccctaaattatta
acagcattaggctgtgatgtgcatgagctgttttgtaatgtggatggccattttcccaat
catcaccctaatcctgcacaacctcagaatatgcaggatatttctaaactggtacgtgat
aagcatttggacattgggctggcgtttgatggggatggcgatcggctgggcgtggttaat
ggagaaggtgaaattatttggccagatcgtttgctgatgttgtttgccagcgatattctg
cagcgccataaaggctcgaccattgtttatgatgtcaaaagtacgggcttattggagcag
gttattaccaaagctggtggcaaagccatgatgtgtccttccggccactcgttaattcgg
gccgaaatgttaaagcatgatgcaaaattggcgggtgagttgagtggacatatctttttt
gccgacaattggtatggttttgacgatgccttatttgccgcctgccgtttgctggcgctg
attgctgatgacccacagcgtcgtggcgcaacagaaatctttgccgcacaaccacaaagg
tttaacactccggaaattttaattgatttagatacagcagaatgccgtcggtttatgaca
caattcacccaaaatgctcaattcgacggtgctgaggttattacgattgatggtgtacgg
gtcaattttgataaaggttggggattggtgagagcgtcaaatacggtgcctggcctaacc
ttgaggtttgaggcagaaacagaagaagatcttgaacagatcaagcagcaatttattcag
caaatgttacaggtgaaacctaatctgagtctgaatttttaa

DBGET integrated database retrieval system