KEGG   Methylophaga sp. JAM1: Q7A_2552Help
Entry
Q7A_2552          CDS       T02055                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mej  Methylophaga sp. JAM1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mej00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2604220..2605677)
Genome map
AA seq 485 aa AA seqDB search
MKQAHIFDNRRTGVLLHITSLPNRNLGADAYRFVDFLHQSGVTVWQMLPLGPTHDDGSPY
QCLSAHAGNNKLLCEAYIKAQPWVHTEELAGKKIYTIVANAYKQFYENANEADWAAFDSF
CQRQAFWLEDYVLYREIRNLNHALPWFDWPVEFRDRDPAALKDLAEQRAESLNIRRFEQF
LFFQQWNNLKTYANQNHVKLFGDMPIFVAHDSADVWAAPELFTLDETGHATKVTGVPPDY
FSTTGQRWGNPLYEWQAHIDENFDWWVKRLSTQLELFDLIRIDHFRGFESCWEIPASCET
AMEGEWGKAPGEALFNRLVAKFGELPLVAEDLGIITEEVTALREKFAMPGMKILQFAFGG
DADNPYLPHQHCRESITYTGTHDNNTSLGWYHELDDAARQHLHQYIGTSDEAMPWLLIRV
ALKSVSQLAVIPMQDLLELESEHRMNIPGTTEGNWKWQFDWNMLPEYCSDKLRQLNQLYG
RIIHE
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagcacatatttttgataaccgtcgaacgggtgtactgctgcatatcaccagt
ttacccaatagaaacttaggggctgatgcctaccgttttgttgatttcttgcaccagtca
ggggtaacagtctggcaaatgctgccattaggacctacacatgatgatggttcgccctat
caatgtttatcggctcacgctggcaataacaaactattatgtgaagcttatattaaagct
caaccttgggtacacaccgaagagctggcgggtaaaaaaatctacacaatcgtggcaaat
gcttacaagcaattctacgaaaacgctaatgaagctgactgggcagcgtttgatagcttt
tgtcagcgacaggcattctggctggaagattatgttttgtatcgtgagatacgcaatctg
aatcatgcgctgccttggtttgactggccagttgaatttcgtgaccgagatccggctgcg
ttgaaagacctggctgagcagcgtgccgaatccctgaatattcgtcgctttgaacaattt
cttttttttcagcaatggaataacttaaaaacctatgccaatcaaaatcacgtcaaattg
ttcggtgatatgccaatatttgttgctcatgacagtgcagatgtttgggcagcacctgag
ctatttactctggatgaaacaggacacgctacaaaagtaaccggtgttccgccagactat
ttctccacaacaggacaacgatgggggaatccgctttatgaatggcaggcgcacattgat
gaaaattttgattggtgggtaaaacgtttgtcgacccaactggagctgtttgatttaatc
cgtatagatcatttcaggggttttgagtcatgctgggaaattccagccagttgcgaaaca
gcaatggaaggcgagtggggtaaagccccaggtgaagctttatttaatagactggtcgca
aaatttggggagcttccgcttgttgcagaagatctgggcatcatcactgaggaggtaact
gctctgcgtgaaaagtttgctatgcctggcatgaagattttgcaatttgcatttggaggc
gatgctgataatccgtatctgcctcatcagcattgcagagagagtattacctataccggt
actcatgataacaataccagtcttggctggtatcatgaacttgatgatgcagcccgacag
catttgcatcaatatattggaaccagcgatgaagcaatgccctggttacttattcgagta
gcattaaaatcagtctcacagcttgctgttattcctatgcaggatttacttgagttagaa
tcagagcatcggatgaacattcctggaactacggagggtaactggaaatggcaatttgac
tggaatatgcttccagaatattgctctgataagttaagacaattaaatcagctatacgga
cgtatcattcatgaataa

DBGET integrated database retrieval system