KEGG   Methylophaga nitratireducenticrescens: Q7A_2552Help
Entry
Q7A_2552          CDS       T02055                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Q7A_2552
Enzymes [BR:mej01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Q7A_2552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2604220..2605677)
Genome map
AA seq 485 aa AA seqDB search
MKQAHIFDNRRTGVLLHITSLPNRNLGADAYRFVDFLHQSGVTVWQMLPLGPTHDDGSPY
QCLSAHAGNNKLLCEAYIKAQPWVHTEELAGKKIYTIVANAYKQFYENANEADWAAFDSF
CQRQAFWLEDYVLYREIRNLNHALPWFDWPVEFRDRDPAALKDLAEQRAESLNIRRFEQF
LFFQQWNNLKTYANQNHVKLFGDMPIFVAHDSADVWAAPELFTLDETGHATKVTGVPPDY
FSTTGQRWGNPLYEWQAHIDENFDWWVKRLSTQLELFDLIRIDHFRGFESCWEIPASCET
AMEGEWGKAPGEALFNRLVAKFGELPLVAEDLGIITEEVTALREKFAMPGMKILQFAFGG
DADNPYLPHQHCRESITYTGTHDNNTSLGWYHELDDAARQHLHQYIGTSDEAMPWLLIRV
ALKSVSQLAVIPMQDLLELESEHRMNIPGTTEGNWKWQFDWNMLPEYCSDKLRQLNQLYG
RIIHE
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagcacatatttttgataaccgtcgaacgggtgtactgctgcatatcaccagt
ttacccaatagaaacttaggggctgatgcctaccgttttgttgatttcttgcaccagtca
ggggtaacagtctggcaaatgctgccattaggacctacacatgatgatggttcgccctat
caatgtttatcggctcacgctggcaataacaaactattatgtgaagcttatattaaagct
caaccttgggtacacaccgaagagctggcgggtaaaaaaatctacacaatcgtggcaaat
gcttacaagcaattctacgaaaacgctaatgaagctgactgggcagcgtttgatagcttt
tgtcagcgacaggcattctggctggaagattatgttttgtatcgtgagatacgcaatctg
aatcatgcgctgccttggtttgactggccagttgaatttcgtgaccgagatccggctgcg
ttgaaagacctggctgagcagcgtgccgaatccctgaatattcgtcgctttgaacaattt
cttttttttcagcaatggaataacttaaaaacctatgccaatcaaaatcacgtcaaattg
ttcggtgatatgccaatatttgttgctcatgacagtgcagatgtttgggcagcacctgag
ctatttactctggatgaaacaggacacgctacaaaagtaaccggtgttccgccagactat
ttctccacaacaggacaacgatgggggaatccgctttatgaatggcaggcgcacattgat
gaaaattttgattggtgggtaaaacgtttgtcgacccaactggagctgtttgatttaatc
cgtatagatcatttcaggggttttgagtcatgctgggaaattccagccagttgcgaaaca
gcaatggaaggcgagtggggtaaagccccaggtgaagctttatttaatagactggtcgca
aaatttggggagcttccgcttgttgcagaagatctgggcatcatcactgaggaggtaact
gctctgcgtgaaaagtttgctatgcctggcatgaagattttgcaatttgcatttggaggc
gatgctgataatccgtatctgcctcatcagcattgcagagagagtattacctataccggt
actcatgataacaataccagtcttggctggtatcatgaacttgatgatgcagcccgacag
catttgcatcaatatattggaaccagcgatgaagcaatgccctggttacttattcgagta
gcattaaaatcagtctcacagcttgctgttattcctatgcaggatttacttgagttagaa
tcagagcatcggatgaacattcctggaactacggagggtaactggaaatggcaatttgac
tggaatatgcttccagaatattgctctgataagttaagacaattaaatcagctatacgga
cgtatcattcatgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system