KEGG   Methylophaga nitratireducenticrescens: Q7A_2555Help
Entry
Q7A_2555          CDS       T02055                                 

Definition
1,4-alpha-glucan (glycogen) branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Q7A_2555
Enzymes [BR:mej01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Q7A_2555
Exosome [BR:mej04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Q7A_2555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2608890..2610899
Genome map
AA seq 669 aa AA seqDB search
MKRVEGTDIFEWTGRSDDLETPYQIHRTTSQNQIQSHYDPYCFPPQLSDYDLYLFAKGKH
WHAYRILGSHKRTVNGVEGVMFATWAPNAQRVSVVGTFNRWDGRSHPMRSRDSTGVWELF
IPGLEIGELYKYEIRNHHDGSLHLKMDPYCQQAELRPGTASVIFDSNYQWHDKEWMSNRE
HTKWLHAPHSVYEVHLGSWQKRNDGSFCSYRELADKLVPYVSKMGFTHIELLPITEHPLD
ISWGYQTTGYYAATSRFGSPDDFRYFVDQCHQNNIGVLLDWVPGHFPKDNFGLAKFDGTA
LYEHEDPRRGEHQDWGTLIFNYGRNEVRNFLLSSAFFWLEECHIDGLRVDAVASMLYLDY
SRQEGQWLPNIHGGRENLEVISFLKEVNTILHQSHPGCIIAAEESTSYPMVSRPADMGGL
GFSMKWNMGWMHDILEYMKQDPIHRRYHHDQLTFGLLYAFTENFVLPFSHDEVVHGKGSM
RYKMPGDEWQQFANLRLLYTFMYSYPGKKLLFMGSEFGQGNEWNSEKALEWYLLDYPKHQ
GLLQLVTDLNKVYRESPALHYHDFDAHGFEWIDCNDREQSVLSYLRQGQDSIAVAVFNFT
PVVRDNYRIGVPEAGEYEVAINSDSEYYSGSNYSVSQVIQSESTSWSDRPYSIVLNLPPL
AGLIIRKKH
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgggttgaaggcacagatatttttgagtggacaggtcgttctgatgacttagaa
acgccataccagattcatcgtaccacttcacaaaatcaaattcagagtcattacgatccg
tactgcttccctccgcaactttcagactacgatctgtatctttttgccaagggtaaacac
tggcatgcctatcgaattctgggatctcacaagcgcactgtaaacggtgtagagggtgtg
atgtttgccacctgggcacccaatgcccaacgtgtcagtgttgttggcactttcaatcgt
tgggatggccgcagccaccccatgcgttccagggacagtactggcgtatgggagttattt
attccgggtctggaaatcggtgagctctacaaatatgaaatacgtaaccatcatgatggc
agtctgcatctgaaaatggatccttattgccagcaggcagaacttcggcctggtacagcg
tcagtgatttttgacagcaattaccaatggcatgacaaagaatggatgtccaacagggaa
catacaaaatggctccatgcgccccatagcgtttatgaagttcacctcggttcctggcaa
aaacgcaatgatggcagcttttgcagttatcgtgaacttgctgacaagctggtgccatat
gtcagcaaaatgggattcacccatattgaactgttacctatcaccgaacaccctctggat
atttcctggggttatcaaaccacaggttattatgctgcgaccagcaggttcggctcaccg
gatgattttcgatattttgtcgaccagtgccatcaaaataatattggcgttttactggat
tgggtgccaggacatttccctaaagacaacttcggcctggccaaatttgatggtaccgcg
ctctatgaacatgaagatccccgtcgtggagaacatcaggactggggtacattaatcttt
aattacggccgcaacgaggttcgtaacttcctgttatccagtgcatttttctggctggaa
gaatgccacatagatggattacgcgtcgatgctgtcgcgtcgatgctttatctcgattat
tcgcgtcaggaaggtcaatggttacctaatattcatggtggtcgtgagaatcttgaggtc
atcagctttctcaaggaagttaataccatactgcatcagtctcatcctggttgtattatc
gccgccgaagaatccacctcctatccaatggtttcacgaccagccgatatgggcggactg
ggtttctcgatgaagtggaatatgggttggatgcacgacatccttgagtatatgaaacaa
gatcccattcatcgtcgttatcatcatgatcagcttacctttggcttgctgtacgcattt
accgaaaactttgtattgcctttttcccatgatgaagttgtgcatggtaaaggttcgatg
cgctacaaaatgcccggagatgagtggcagcaatttgctaatctgcggttactttatacc
tttatgtacagctatcccggcaaaaaattattatttatgggatcagagtttggtcagggc
aatgagtggaatagtgaaaaagcactggaatggtatttactggattacccaaaacatcag
ggcctgttacagctggtcacagatttaaataaagtctaccgtgaaagccctgcgcttcat
tatcatgactttgacgcgcatggatttgaatggattgattgcaatgatcgggaacagtca
gtacttagctacctgcgtcagggacaggactccatcgctgtggccgtgtttaatttcacg
cctgtagtgagggataattaccgaattggtgtgcctgaagcaggtgaatatgaggttgcc
atcaattctgactcggagtactacagtggcagtaattattctgttagtcaggtaattcag
agcgaatcaacaagctggtccgacagaccctactcaattgtattgaacttaccacctttg
gctggactgattattcgtaaaaagcattaa

DBGET integrated database retrieval system