KEGG   Methylophaga nitratireducenticrescens: Q7A_260Help
Entry
Q7A_260           CDS       T02055                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Q7A_260
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Q7A_260
Enzymes [BR:mej01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Q7A_260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
271164..272135
Genome map
AA seq 323 aa AA seqDB search
MPSNQLTESGQLRHFLTIEGLKRPLLTEIMDRAEQFSGISHRQVKKVPLLRGKTIINLFF
ENSTRTRSTFELAAKRLSADVMNFNINTSATSKGESLLDTLHNLEAMHTDMFVVRHDQSG
AAEFIAQHVAPHVSVINAGDGCHAHPTQAMLDMFTIRRHKHDFANLRVAIIGDILHSRVA
RSQIQALATLGVGEIRVIGPQTLLPRESQTLGVHVYHDMESGLEGVDVVITLRLQLERMQ
GALLPSAREYFRCYGLTEEKLKYAKPDAIVMHPGPINRGVEIASSVADGPQSVILEQVTH
GIAIRMAVMSMALASQSEQAEIE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgccgagtaatcaactgacagagagcggccagctgagacattttctgaccattgaaggt
ctgaaacgccctttattaaccgaaattatggatcgggctgaacagttctccggaatcagt
caccgtcaagtaaaaaaggtcccgttgcttcgcggcaaaaccattattaatctgtttttt
gaaaacagtacccgtacccgctcaactttcgaactggccgccaaaagactgtccgccgat
gtgatgaattttaatatcaacacatccgccacttccaaaggcgaaagcctgctcgacact
ctgcataatcttgaagccatgcacacagatatgtttgtggttcgccatgatcaaagtggt
gcagccgagtttattgctcagcatgtggcaccacatgtcagcgtaattaatgctggtgac
ggttgtcatgctcaccccacccaggcgatgctggatatgtttaccatccgccgccacaaa
cacgattttgccaatttacgtgtagcgatcattggcgatattctgcattcgcgtgtggca
cgttcgcagattcaggctttagcaacacttggtgttggtgaaatccgcgttattggtcca
cagactttattgccaagagaaagtcagacccttggggtacatgtttatcacgatatggaa
agcggccttgagggggtcgatgtggtgataaccctgcgcctgcaactggaacgtatgcaa
ggggcattgttacccagcgctcgagaatatttccgctgttacgggctaacagaagaaaaa
ctcaaatatgccaaaccggatgccatcgttatgcatcccggccccattaatcgaggcgta
gagatagcctcatcggttgctgatgggccgcaatcagtaattcttgaacaggtaacccac
ggcattgctatccgtatggcggtgatgtcgatggcgctggccagtcaatcagaacaggca
gagatcgaataa

DBGET integrated database retrieval system