KEGG   Methylophaga nitratireducenticrescens: Q7A_2713Help
Entry
Q7A_2713          CDS       T02055                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mej00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Q7A_2713
Enzymes [BR:mej01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Q7A_2713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2755859..2757613)
Genome map
AA seq 584 aa AA seqDB search
MNALKLLREAGFSELAYQFAAYISRQQQNEEPIVTLTAGLLSETVSEGHVCLNLNDFQSL
NPVIQSAIPEATLWLDHLQNSEIIGAPGEFKPLVLTTDGLLYLYRYWQSEQQVAIAIQQR
LKDGETLPAAENLSTFMADWQNHLPDTDWQKVAVLSALRRQLCVISGGPGTGKTTVVLKI
LQCLQLNDDKPRVALAAPTGKAAARLQQAISQHTGEQYVAKTLHRLLGISARFDQGRYSA
ERPLPVDVLIVDEASMIDINLMATTLKVLPLHARLILLGDSDQLASVESGAVLANLCADT
PDFSADFRSWVKQISEIELPVSRDDNLLQDSLVKLKHSYRFAAGGLVGQLAQAVNRGDAG
QVTDLLVNQSLSALSVPSTENIQTQLLNGYQRFIETIEKRADAVSCIQAFEAYRMLCAVK
NRPQSVYSVNQLMSQLLAKRGWRTAQPYYPGRPVMITQNHYRQNLFNGDIGLVLPNADGE
LQACFLFGEELRWLPLSRLPAHETVFAMTVHKSQGSEFDHVSLLLPQEDSAVLSRELVYT
ALTRARQTVNILSTQPVLQQAVLRRHQRESGLAQLLANIRQTIS
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccttgaaactactgcgagaagcggggttttccgagctggcttatcagtttgca
gcctatattagccgtcagcaacagaatgaagagccaatcgttaccctgacggctgggctg
cttagcgaaaccgttagtgaaggccatgtgtgtctgaatctgaatgactttcaatcactt
aatccggttattcagagcgcgatccctgaagcgacactgtggttggaccatctgcaaaac
agtgaaattatcggtgctcccggcgagtttaaaccgttagtgctgacaaccgatggcttg
ttgtacctgtatcgctactggcaatcagaacaacaggtagcaattgccatacaacagcga
ctgaaggacggggaaaccctgccagctgcagaaaatctgtcgacatttatggcggattgg
caaaatcacctacccgataccgactggcagaaagttgcggtgttaagtgcattacgccga
cagttgtgtgtgatttcaggtggtcccggcaccgggaaaaccacggtggtgttaaaaatt
ctgcaatgtctgcaattaaacgacgataaaccgcgggtagctttggcggctcctacaggc
aaagctgcggctagactgcaacaagcaatcagtcagcatactggtgagcaatatgttgct
aaaacgctgcatcgcttactgggcatcagtgcacgttttgatcaggggcgctattcagca
gaacggccattgccggttgatgtgctgattgttgatgaagcgtcgatgattgatatcaat
ctgatggcgactacactgaaagttttaccattgcacgcgaggttgattttattgggcgac
agcgatcaattagcctcagtcgaatccggcgcagtactcgctaacttatgtgccgacaca
ccggatttttcggctgatttcagatcctgggtgaaacagatcagcgaaatagagctaccg
gtttcgagggatgacaatctcttgcaggattcgctggtcaaattaaagcacagctatcgt
tttgcagcgggaggactggtcggtcaactggctcaggcagtcaatagaggagatgctggt
caggtgacggatttattggtaaatcaatctttatccgccttaagtgtgccttcaacagag
aatatacaaacccagttactcaacggatatcagcgttttatcgagactatcgaaaaacgg
gcagatgcggtgagttgtattcaggcatttgaagcgtatcgaatgctttgtgcggtgaaa
aatagaccgcaatcggtgtattcagtgaatcagctgatgagccagttgctggcaaaacgt
ggctggcgaacagcgcagccatattatcccggacggccagtgatgattacgcagaatcat
tatcggcagaatctgtttaatggcgatattggtttggtgttgccgaatgccgacggtgaa
ctgcaggcctgttttctattcggtgaggagttacgctggttgccattaagccgtttaccg
gcgcatgaaacagtgtttgcgatgacggtgcataaaagccagggatcagagtttgaccac
gtctcactgttactaccccaggaagattcggccgtgttaagtcgggagctggtttatacc
gcgctcaccagagcgcgacaaacggtgaatatcttgtcgacacagcctgttttgcagcag
gctgttttacgtcgacatcaacgggaaagtggtttggcgcagttacttgccaatatccgc
cagacgatttcttaa

DBGET integrated database retrieval system