KEGG   Methylophaga sp. JAM1: Q7A_2713Help
Entry
Q7A_2713          CDS       T02055                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mej  Methylophaga sp. JAM1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mej03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2755859..2757613)
Genome map
AA seq 584 aa AA seqDB search
MNALKLLREAGFSELAYQFAAYISRQQQNEEPIVTLTAGLLSETVSEGHVCLNLNDFQSL
NPVIQSAIPEATLWLDHLQNSEIIGAPGEFKPLVLTTDGLLYLYRYWQSEQQVAIAIQQR
LKDGETLPAAENLSTFMADWQNHLPDTDWQKVAVLSALRRQLCVISGGPGTGKTTVVLKI
LQCLQLNDDKPRVALAAPTGKAAARLQQAISQHTGEQYVAKTLHRLLGISARFDQGRYSA
ERPLPVDVLIVDEASMIDINLMATTLKVLPLHARLILLGDSDQLASVESGAVLANLCADT
PDFSADFRSWVKQISEIELPVSRDDNLLQDSLVKLKHSYRFAAGGLVGQLAQAVNRGDAG
QVTDLLVNQSLSALSVPSTENIQTQLLNGYQRFIETIEKRADAVSCIQAFEAYRMLCAVK
NRPQSVYSVNQLMSQLLAKRGWRTAQPYYPGRPVMITQNHYRQNLFNGDIGLVLPNADGE
LQACFLFGEELRWLPLSRLPAHETVFAMTVHKSQGSEFDHVSLLLPQEDSAVLSRELVYT
ALTRARQTVNILSTQPVLQQAVLRRHQRESGLAQLLANIRQTIS
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccttgaaactactgcgagaagcggggttttccgagctggcttatcagtttgca
gcctatattagccgtcagcaacagaatgaagagccaatcgttaccctgacggctgggctg
cttagcgaaaccgttagtgaaggccatgtgtgtctgaatctgaatgactttcaatcactt
aatccggttattcagagcgcgatccctgaagcgacactgtggttggaccatctgcaaaac
agtgaaattatcggtgctcccggcgagtttaaaccgttagtgctgacaaccgatggcttg
ttgtacctgtatcgctactggcaatcagaacaacaggtagcaattgccatacaacagcga
ctgaaggacggggaaaccctgccagctgcagaaaatctgtcgacatttatggcggattgg
caaaatcacctacccgataccgactggcagaaagttgcggtgttaagtgcattacgccga
cagttgtgtgtgatttcaggtggtcccggcaccgggaaaaccacggtggtgttaaaaatt
ctgcaatgtctgcaattaaacgacgataaaccgcgggtagctttggcggctcctacaggc
aaagctgcggctagactgcaacaagcaatcagtcagcatactggtgagcaatatgttgct
aaaacgctgcatcgcttactgggcatcagtgcacgttttgatcaggggcgctattcagca
gaacggccattgccggttgatgtgctgattgttgatgaagcgtcgatgattgatatcaat
ctgatggcgactacactgaaagttttaccattgcacgcgaggttgattttattgggcgac
agcgatcaattagcctcagtcgaatccggcgcagtactcgctaacttatgtgccgacaca
ccggatttttcggctgatttcagatcctgggtgaaacagatcagcgaaatagagctaccg
gtttcgagggatgacaatctcttgcaggattcgctggtcaaattaaagcacagctatcgt
tttgcagcgggaggactggtcggtcaactggctcaggcagtcaatagaggagatgctggt
caggtgacggatttattggtaaatcaatctttatccgccttaagtgtgccttcaacagag
aatatacaaacccagttactcaacggatatcagcgttttatcgagactatcgaaaaacgg
gcagatgcggtgagttgtattcaggcatttgaagcgtatcgaatgctttgtgcggtgaaa
aatagaccgcaatcggtgtattcagtgaatcagctgatgagccagttgctggcaaaacgt
ggctggcgaacagcgcagccatattatcccggacggccagtgatgattacgcagaatcat
tatcggcagaatctgtttaatggcgatattggtttggtgttgccgaatgccgacggtgaa
ctgcaggcctgttttctattcggtgaggagttacgctggttgccattaagccgtttaccg
gcgcatgaaacagtgtttgcgatgacggtgcataaaagccagggatcagagtttgaccac
gtctcactgttactaccccaggaagattcggccgtgttaagtcgggagctggtttatacc
gcgctcaccagagcgcgacaaacggtgaatatcttgtcgacacagcctgttttgcagcag
gctgttttacgtcgacatcaacgggaaagtggtttggcgcagttacttgccaatatccgc
cagacgatttcttaa

DBGET integrated database retrieval system