KEGG   Methylophaga sp. JAM1: Q7A_2903Help
Entry
Q7A_2903          CDS       T02055                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mej  Methylophaga sp. JAM1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Q7A_2903
Enzymes [BR:mej01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Q7A_2903
Exosome [BR:mej04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Q7A_2903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2942738..2943748
Genome map
AA seq 336 aa AA seqDB search
MTQQYFNFSAFPQQRPRRLRKDDFSRRLVREHQLTVDDLIYPCFVLEGKSQREKVTSMPG
VERLSIDLLLQEAEIIHKLGIPMMALFPVIPLEQKSLDAAEAFNPDGLAQRAVRALKKAF
PDLGVMTDVALDPFTTHGQDGLIDDNAYIINDETVEVLIKQAISHAEAGADVVAPSDMMD
GRIGAIRNALENAGHIHTRIMAYSAKYASSFYGPFRDAVGSAGNLAGGNKFSYQMDPANS
DEALHEVALDIQEGADMVMVKPGMPYLDVLYRVKQTFQKPTFVYQVSGEYAMLKAATLKG
WLGEEVIMESLLAFKRAGADGILTYFAKDIAQKLQR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacccaacagtattttaatttttccgcttttccacaacaaagaccccgtcgtttgcgc
aaagatgacttttcccggcgactggttcgagagcaccagctaaccgtcgatgatctgatt
tatccctgctttgtactcgaaggcaaaagtcaacgagaaaaagtcacttcaatgcctggg
gtggagagactgagcattgatttgctgcttcaggaagctgaaattatccacaaattgggc
atcccgatgatggcattgtttccagtgatcccattggaacagaaatcgctggatgctgct
gaagcgtttaatcccgatggtttggcgcaacgggccgtcagagcattaaaaaaagccttc
cccgatttgggtgtgatgactgatgttgctctggatccctttaccacccacggccaggat
ggcttgatcgatgacaacgcttatattattaatgatgaaacagtcgaagtactgatcaaa
caggcgatatctcatgctgaggctggagccgatgtagttgccccctccgatatgatggat
ggacgaattggcgcgatacgcaatgctctggaaaatgccggacatatacatacccggatc
atggcttactccgccaaatatgcctccagtttttatggaccatttcgtgatgctgtgggc
agtgcagggaatttagccggtggcaataaattcagttatcagatggatccagcaaattct
gatgaggccttacatgaagtcgctttggatattcaggaaggtgctgatatggtgatggtc
aaacccggcatgccttatctggatgtgctgtatcgggtgaaacagacgtttcaaaaaccg
acctttgtctatcaggtcagtggtgaatatgcgatgctcaaggcagcaacgttaaaaggc
tggctaggtgaagaagtgattatggaaagcctgctggcattcaagcgtgcgggtgccgac
ggtatcctcacctactttgccaaagatattgcccaaaaattacaacgctga

DBGET integrated database retrieval system