KEGG   Methylophaga nitratireducenticrescens: Q7A_2903Help
Entry
Q7A_2903          CDS       T02055                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Q7A_2903
Enzymes [BR:mej01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Q7A_2903
Exosome [BR:mej04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Q7A_2903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2709684..2710706
Genome map
AA seq 340 aa AA seqDB search
MAELMTQQYFNFSAFPQQRPRRLRKDDFSRRLVREHQLTVDDLIYPCFVLEGKSQREKVT
SMPGVERLSIDLLLQEAEIIHKLGIPMMALFPVIPLEQKSLDAAEAFNPDGLAQRAVRAL
KKAFPDLGVMTDVALDPFTTHGQDGLIDDNAYIINDETVEVLIKQAISHAEAGADVVAPS
DMMDGRIGAIRNALENAGHIHTRIMAYSAKYASSFYGPFRDAVGSAGNLAGGNKFSYQMD
PANSDEALHEVALDIQEGADMVMVKPGMPYLDVLYRVKQTFQKPTFVYQVSGEYAMLKAA
TLKGWLGEEVIMESLLAFKRAGADGILTYFAKDIAQKLQR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
ctggcagaacttatgacccaacagtattttaatttttccgcttttccacaacaaagaccc
cgtcgtttgcgcaaagatgacttttcccggcgactggttcgagagcaccagctaaccgtc
gatgatctgatttatccctgctttgtactcgaaggcaaaagtcaacgagaaaaagtcact
tcaatgcctggggtggagagactgagcattgatttgctgcttcaggaagctgaaattatc
cacaaattgggcatcccgatgatggcattgtttccagtgatcccattggaacagaaatcg
ctggatgctgctgaagcgtttaatcccgatggtttggcgcaacgggccgtcagagcatta
aaaaaagccttccccgatttgggtgtgatgactgatgttgctctggatccctttaccacc
cacggccaggatggcttgatcgatgacaacgcttatattattaatgatgaaacagtcgaa
gtactgatcaaacaggcgatatctcatgctgaggctggagccgatgtagttgccccctcc
gatatgatggatggacgaattggcgcgatacgcaatgctctggaaaatgccggacatata
catacccggatcatggcttactccgccaaatatgcctccagtttttatggaccatttcgt
gatgctgtgggcagtgcagggaatttagccggtggcaataaattcagttatcagatggat
ccagcaaattctgatgaggccttacatgaagtcgctttggatattcaggaaggtgctgat
atggtgatggtcaaacccggcatgccttatctggatgtgctgtatcgggtgaaacagacg
tttcaaaaaccgacctttgtctatcaggtcagtggtgaatatgcgatgctcaaggcagca
acgttaaaaggctggctaggtgaagaagtgattatggaaagcctgctggcattcaagcgt
gcgggtgccgacggtatcctcacctactttgccaaagatattgcccaaaaattacaacgc
tga

DBGET integrated database retrieval system