KEGG   Methylophaga nitratireducenticrescens: Q7A_3063Help
Entry
Q7A_3063          CDS       T02055                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Q7A_3063
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q7A_3063
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Q7A_3063
Enzymes [BR:mej01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Q7A_3063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3089855..3091000)
Genome map
AA seq 381 aa AA seqDB search
MPFRPRYTGLIDRYRDRLPVNDDTRLISLGEGNTPLLKLNNIPKLIGKDVDIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYAARAGITAFVIIPDGKIAQG
KLAQAMMHNAVVIQIKGNFDEGMQLVKDVAEHAPVTIVNSINPYRLQGQKTAAFEIIEEL
GRAPDYHCLPVGNAGNITAHWIGYCEYSSASGDHVTEACAYCHGNCKYAGGAIVGNRPKM
VGYQANGSAPFMRGAMVDDPETVATAIRIGHPQSWDMAWKVKEESQGWFDECSDEEILAA
QKLLAEKEGIFCEPASATSVAGALRDIQSGKIPEGSTVVCTLTGHGLKDPDIAIKQSSSP
VITVDATLDSVRDAIINNLAR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgccatttcgtccacgttataccggcctgattgaccgctatcgtgaccgtttgccggtc
aatgatgacaccagactgatcagtcttggtgaaggtaatacaccattattgaaattgaac
aatatccccaaattaattggcaaagatgttgatatctacgtcaaatatgaaggattgaat
cctacgggttctttcaaagatcgtggtatgaccatggcagtgaccaaagctgtggaagag
ggaagtaaagccattatttgtgcttctactggtaatacctcagcagcagcggctgcctat
gctgcacgtgctggtatcactgcttttgttattattcctgatggcaaaattgcccagggt
aaattagctcaggccatgatgcacaacgcagtggttatccaaatcaaaggcaattttgat
gaaggcatgcaactggttaaagatgttgcagagcatgcaccagtcaccattgtaaattcg
attaatccttatcgtttgcaaggtcagaaaactgctgcgtttgagatcattgaagagtta
ggtcgtgcgccggattatcactgcttgccagtcggtaacgctggtaatatcaccgcacac
tggattggctactgtgagtattcctcagccagtggtgatcatgtcactgaagcctgcgcg
tactgtcatggcaattgtaaatatgctggtggtgcaattgtgggtaaccgccccaaaatg
gtgggttatcaggctaatggcagtgcaccgtttatgcgtggtgcgatggttgatgatcct
gaaacagtggctaccgcgattcgtattggtcatccacaaagctgggatatggcctggaaa
gtgaaagaagaatcacagggttggtttgatgagtgctctgatgaagaaatattggctgcc
cagaaattactggcagaaaaggaaggtattttctgtgagccagcttcagcaacttccgtt
gctggggcattacgtgatattcagtccggcaagattcctgaaggcagtaccgttgtgtgt
acgttgacaggtcacggcctgaaagatccggacattgcgatcaaacaaagtagttcacct
gtgattactgttgatgctacattggactcagtacgtgatgcgattatcaacaacttggcc
agataa

DBGET integrated database retrieval system