KEGG   Methylophaga nitratireducenticrescens: Q7A_335Help
Entry
Q7A_335           CDS       T02055                                 

Definition
folM Alternative dihydrofolate reductase 1
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Q7A_335
   00670 One carbon pool by folate
    Q7A_335
Enzymes [BR:mej01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Q7A_335
    1.5.1.-  
     Q7A_335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
341890..342609
Genome map
AA seq 239 aa AA seqDB search
MNNPILVTGAGKRVGFHIASRLKQDGYEVLAHYRTETDDVQKLKQLDIQTIQADLQDTAS
IMEFIDKLQQFSPAYRGIVHNASAFTPTADDLVEAAEQYQHFFTIHMLAPFLINQALSKL
LKGPGNDPADIIHITDINVENPTPRFDIYGTTKAGLHNLTLVSAKKLAPQIKVNSVAPGP
VLFTESHTQEARQKMLSETPLAREGGAEPVYLAIKSLLENPFITGATIPVDGGRRLSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
gtgaataatcccattttagtaacaggtgccggaaagcgggtcggatttcatatcgcttcc
aggctaaagcaggatggttatgaggtattggcacattaccgtactgaaacggatgatgtc
caaaaactaaaacaattagacatacagactattcaggctgatttgcaggatactgccagc
attatggagtttatcgacaaactgcagcaattcagtccggcttatcgaggcattgtgcat
aatgcctcagcatttacaccgacagcagatgatttggttgaggctgcggagcaatatcaa
catttttttaccatacatatgttagcgccgtttctgatcaatcaggcgttatcaaagcta
ttaaagggaccaggcaatgatccggccgatattattcatatcaccgatatcaatgttgaa
aaccctaccccacggtttgatatttatggcacaaccaaagcgggattgcataacctgacg
ctggtgtcggcaaaaaaacttgctccgcagatcaaggtgaattcagtggctccgggaccc
gttttattcaccgagtcacatacacaggaagccaggcagaaaatgctatctgaaaccccg
ctggcccgtgaaggtggtgcggagccggtttatctcgccataaaaagcttgttagagaac
ccctttattaccggcgcgactatcccagtagatggtggtcgccgtctctccaaagcgtaa

DBGET integrated database retrieval system