KEGG   Methylophaga sp. JAM1: Q7A_335Help
Entry
Q7A_335           CDS       T02055                                 

Definition
folM Alternative dihydrofolate reductase 1
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
mej  Methylophaga sp. JAM1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mej00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mej00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
341890..342609
Genome map
AA seq 239 aa AA seqDB search
MNNPILVTGAGKRVGFHIASRLKQDGYEVLAHYRTETDDVQKLKQLDIQTIQADLQDTAS
IMEFIDKLQQFSPAYRGIVHNASAFTPTADDLVEAAEQYQHFFTIHMLAPFLINQALSKL
LKGPGNDPADIIHITDINVENPTPRFDIYGTTKAGLHNLTLVSAKKLAPQIKVNSVAPGP
VLFTESHTQEARQKMLSETPLAREGGAEPVYLAIKSLLENPFITGATIPVDGGRRLSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
gtgaataatcccattttagtaacaggtgccggaaagcgggtcggatttcatatcgcttcc
aggctaaagcaggatggttatgaggtattggcacattaccgtactgaaacggatgatgtc
caaaaactaaaacaattagacatacagactattcaggctgatttgcaggatactgccagc
attatggagtttatcgacaaactgcagcaattcagtccggcttatcgaggcattgtgcat
aatgcctcagcatttacaccgacagcagatgatttggttgaggctgcggagcaatatcaa
catttttttaccatacatatgttagcgccgtttctgatcaatcaggcgttatcaaagcta
ttaaagggaccaggcaatgatccggccgatattattcatatcaccgatatcaatgttgaa
aaccctaccccacggtttgatatttatggcacaaccaaagcgggattgcataacctgacg
ctggtgtcggcaaaaaaacttgctccgcagatcaaggtgaattcagtggctccgggaccc
gttttattcaccgagtcacatacacaggaagccaggcagaaaatgctatctgaaaccccg
ctggcccgtgaaggtggtgcggagccggtttatctcgccataaaaagcttgttagagaac
ccctttattaccggcgcgactatcccagtagatggtggtcgccgtctctccaaagcgtaa

DBGET integrated database retrieval system