KEGG   Methylophaga nitratireducenticrescens: Q7A_335Help
Entry
Q7A_335           CDS       T02055                                 

Definition
(GenBank) short-chain dehydrogenase
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej00670  One carbon pool by folate
mej00790  Folate biosynthesis
mej01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Q7A_335
   00670 One carbon pool by folate
    Q7A_335
Enzymes [BR:mej01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Q7A_335
    1.5.1.50  dihydromonapterin reductase
     Q7A_335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase NmrA KR RmlD_sub_bind NAD_binding_10 DHquinase_II GDP_Man_Dehyd TrkA_N
Motif
Other DBs
NCBI-ProteinID: AFI83193
UniProt: I1XFM4
Position
341897..342616
Genome map
AA seq 239 aa AA seqDB search
MNNPILVTGAGKRVGFHIASRLKQDGYEVLAHYRTETDDVQKLKQLDIQTIQADLQDTAS
IMEFIDKLQQFSPAYRGIVHNASAFTPTADDLVEAAEQYQHFFTIHMLAPFLINQALSKL
LKGPGNDPADIIHITDINVENPTPRFDIYGTTKAGLHNLTLVSAKKLAPQIKVNSVAPGP
VLFTESHTQEARQKMLSETPLAREGGAEPVYLAIKSLLENPFITGATIPVDGGRRLSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
gtgaataatcccattttagtaacaggtgccggaaagcgggtcggatttcatatcgcttcc
aggctaaagcaggatggttatgaggtattggcacattaccgtactgaaacggatgatgtc
caaaaactaaaacaattagacatacagactattcaggctgatttgcaggatactgccagc
attatggagtttatcgacaaactgcagcaattcagtccggcttatcgaggcattgtgcat
aatgcctcagcatttacaccgacagcagatgatttggttgaggctgcggagcaatatcaa
catttttttaccatacatatgttagcgccgtttctgatcaatcaggcgttatcaaagcta
ttaaagggaccaggcaatgatccggccgatattattcatatcaccgatatcaatgttgaa
aaccctaccccacggtttgatatttatggcacaaccaaagcgggattgcataacctgacg
ctggtgtcggcaaaaaaacttgctccgcagatcaaggtgaattcagtggctccgggaccc
gttttattcaccgagtcacatacacaggaagccaggcagaaaatgctatctgaaaccccg
ctggcccgtgaaggtggtgcggagccggtttatctcgccataaaaagcttgttagagaac
ccctttattaccggcgcgactatcccagtagatggtggtcgccgtctctccaaagcgtaa

DBGET integrated database retrieval system