KEGG   Methylophaga nitratireducenticrescens: Q7A_503Help
Entry
Q7A_503           CDS       T02055                                 

Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej00900  Terpenoid backbone biosynthesis
mej01100  Metabolic pathways
mej01110  Biosynthesis of secondary metabolites
mej01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Q7A_503
Enzymes [BR:mej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Q7A_503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C GH97_C
Motif
Other DBs
NCBI-ProteinID: AFI83351
UniProt: I1XG32
Position
515419..516288
Genome map
AA seq 289 aa AA seqDB search
MNKWWPAPAKLNLFLHITGRRPDGYHELQTAFQFLDHGDKLKFTITENAQITLKADLPEV
VEEDNLIVKAARLLQTSCKSRSGAIIQLEKNLPMGGGLGGGSSDAATTLVALNKLWQCGL
TEDQLASLGLQLGADVPVFVRGHAAWAEGVGEIFTKIEPPEPWYLVIFPECAVSTAEIFS
ATQLTRDCEPITIAGFLAGEGSNICESVVTKLHPPVAQALAWLAQYATIPRMTGTGSCVF
ARFESASAAENVLEHVPAHWHAFTAKGCNESPLSFCAKDFDRRLDVTAI
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatggtggcctgcaccggcaaaactaaatctgtttttacatatcaccggcaga
cggccagatgggtatcatgagttacagacggcatttcagtttcttgatcatggtgacaaa
cttaaatttactatcaccgaaaacgcacagatcacgctaaaagccgatcttcctgaggtt
gttgaagaggataatctgattgtaaaagctgcccgtcttttacagacaagctgtaaaagt
cgatcaggagccattatccaactggaaaaaaacctgccaatgggaggcggtctgggaggg
ggcagttcggatgcagcgacaacccttgttgcgctaaataagctttggcaatgtggttta
acagaagatcaattagcgagcctggggttgcagctaggcgcagatgtaccggtttttgtg
cgaggtcacgccgcctgggccgaaggtgtgggagaaatttttactaaaattgaaccacca
gaaccgtggtatttagttatcttccccgaatgtgccgtctcaacagcagaaatattttct
gcaacgcaattgacacgtgattgtgaacccatcacaatagcgggcttccttgcgggggaa
ggcagtaatatatgcgaatcggtggtaacaaaattgcatccaccagttgcacaagcactg
gcatggttggcacaatatgcaaccattccacgaatgaccggaacgggttcttgtgttttt
gcccgctttgaatcggccagtgcggctgaaaatgttttagaacatgtgccggcacactgg
catgcttttactgcaaaaggctgcaacgaatcaccgttgagtttttgtgcaaaagacttc
gatagacgtcttgatgtaactgcaatttga

DBGET integrated database retrieval system