KEGG   Methylophaga nitratireducenticrescens: Q7A_509Help
Entry
Q7A_509           CDS       T02055                                 

Definition
(GenBank) phospholipase
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej00564  Glycerophospholipid metabolism
mej00565  Ether lipid metabolism
mej00590  Arachidonic acid metabolism
mej00592  alpha-Linolenic acid metabolism
mej01100  Metabolic pathways
mej01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Q7A_509
   00565 Ether lipid metabolism
    Q7A_509
   00590 Arachidonic acid metabolism
    Q7A_509
   00591 Linoleic acid metabolism
    Q7A_509
   00592 alpha-Linolenic acid metabolism
    Q7A_509
Enzymes [BR:mej01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Q7A_509
    3.1.1.32  phospholipase A1
     Q7A_509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: AFI83356
UniProt: I1XG37
Position
520039..521106
Genome map
AA seq 355 aa AA seqDB search
MNKWFAGAIFTSIMMSSAHADQAMDECILSKMATSDDSVTVGNIREICIAEISMQKQEQT
EPAYLSEMTEDDQESISIDENEATKIETADGSALSRRLVLEKSQSNNPFAFLPHRPNYFI
FSNNVGSYNEAPFDAADPDRDYDFQSWESKFQISLKLPVVRGLFNDRADAFIAYTNRSFW
QMFNNDNSQAFRDSNHEPEAWLSFANDTELFGFKNSLINVGFNHQSNGQNGALSRSWNRI
FAEFIVEKGDFYFSVRPWYRVPERDSSDDNPDIEKYMGNFDFTSVYKYGDHSFDLMIRNN
LRSDNKGATQLGWSFPLYKNFRGYVQWFNGYGESMIDYDHRTNSIGFGIQFSDWL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatggtttgccggggcgatattcacatcaatcatgatgagttcagcacatgcc
gaccaggccatggatgaatgcatactgtcaaaaatggccacatctgatgatagtgtcact
gtcggcaatattcgtgaaatctgtatagcagaaatttccatgcaaaagcaagagcagact
gagccggcatatctttctgagatgactgaggatgatcaggaaagcatttcaattgatgag
aacgaggctacaaaaatcgaaacagccgatggttcagcgttatccagacgtttggttctg
gaaaaaagccagtcaaataacccgtttgctttcttgccacatcgtccgaattatttcatt
ttcagtaataatgtcggttcatataacgaagccccatttgacgcagccgatccagatcga
gattatgattttcagtcatgggaaagcaagtttcagatcagcttgaaactccctgttgtc
agaggattgttcaatgatcgggctgatgcgtttatcgcctacaccaaccgctctttctgg
caaatgtttaataacgataattcacaggcattccgagattccaatcacgaaccagaagca
tggctctcttttgccaatgatacggagttattcgggtttaaaaactcactgattaatgtc
ggttttaatcatcaatcgaatggacagaatggggcgttatcgcgtagctggaatcgtata
tttgccgagtttattgtagaaaaaggtgatttttacttctccgttcgcccctggtatcgg
gttcctgaaagagatagttcagacgataacccggatattgaaaaatatatggggaatttt
gatttcacgtcagtttataaatatggcgaccacagctttgacctgatgatacgcaataac
ctgcgcagcgataataaaggcgctactcaactgggatggagctttccgctctataaaaac
ttcagaggttatgtgcagtggtttaatggctatggcgaaagcatgattgattatgatcac
cgcaccaacagcatagggtttggtatccagttcagcgactggttataa

DBGET integrated database retrieval system