KEGG   Methylophaga sp. JAM1: Q7A_662Help
Entry
Q7A_662           CDS       T02055                                 

Definition
diguanylate cyclase/phosphodiesterase
Orthology
K13590  
diguanylate cyclase
Organism
mej  Methylophaga sp. JAM1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(668871..669908)
Genome map
AA seq 345 aa AA seqDB search
MSTSSSFPPVYTEPFHQASENLRRALPFINQHQTPVNPVNYAVWYEYVSGTNQALKKAID
SRLQQKQKITAEITQQLYEKYVLMGMPERLEATNNGLRLVVDNTMNQINKVELAADDFSE
DLAVQQTRLEQSEDISVIKGVLSEILENTRRLGQSGNELKQELAETTQEILKLRSELEAV
KQEAITDGLTGLLNRRYLNKELAELCHQGKNVFTLALFDLDNFKQVNDRFGHLLGDRVLQ
FFASLLKKHCENQQHIAARFGGEEMALIFIDTPSNIAMQIADTIRQQLAGSNLKKKDSTE
TIGAVTVSVGLSQYQPGDTTLNIIERADVALYESKAAGRNCITLR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaacgtcatcatcattcccacccgtttacactgaaccttttcatcaggcctctgaa
aatctgcgccgagcattaccctttatcaatcagcatcaaaccccggttaacccggtaaat
tacgccgtctggtatgaatatgtctcaggcaccaatcaggcattaaaaaaagcgattgac
agtcgattacaacagaaacagaaaatcacagcggaaatcactcagcagctttatgaaaaa
tacgtcttaatgggcatgcctgaaaggcttgaggccactaataatggccttagactggtc
gtcgacaacacgatgaatcaaatcaataaggttgaactggcagctgatgacttttcagaa
gatttagctgttcagcaaacgagactggaacaatccgaggatatttcagtaatcaaaggt
gtgttgtcagaaatactggaaaatactcgtcgactcggacagtcaggtaatgaactgaaa
caagaactggctgaaaccacacaggaaattctgaaactcagatcagaattggaagccgta
aaacaggaagccataactgacgggttaactggtctgttaaatcgtcgctacctcaacaaa
gaacttgccgagttgtgccatcaaggtaaaaacgtatttacattagccctgtttgatctc
gataactttaaacaggtgaatgacaggttcggtcatttacttggggatcgcgtcctgcaa
ttctttgccagtctgctgaaaaaacattgtgagaatcaacaacatattgcagcacgtttt
ggtggtgaagagatggcgttgatttttattgatactccatcaaacatagcaatgcaaatt
gccgatactattcgtcagcaactcgcgggaagtaacctgaagaaaaaagacagcactgaa
accattggagcggtgactgtttcggttggcctgagtcaatatcagcccggggataccaca
ttgaatattattgaacgtgccgatgtcgctttatatgaatcaaaagcggctggccgaaat
tgtattacgttacgttaa

DBGET integrated database retrieval system