KEGG   Methylophaga sp. JAM1: Q7A_678Help
Entry
Q7A_678           CDS       T02055                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mej  Methylophaga sp. JAM1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mej00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mej00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
683131..684417
Genome map
AA seq 428 aa AA seqDB search
MDKLIIKGGVALDGEIRISGAKNAALPILMGALLADSPVRIGNVPHLHDITTTLELLGRM
GVTLTVDERSGVLIDPSTLTITEAAYDLVKTMRASILVLGPLLARFGKADVSLPGGCAIG
SRPVDLHLRGLEQMGAEIKVENGYIRATSGKGLKGAHIFMDQVTVTGTENLMMAATLAKG
TTIIENAAREPEVVDLAKYLNQMGAKITGAGSTTIQIEGVKKLNGTHYAILPDRIETGTY
LVAAAITRGRVKLKDTDANQLEAVLLKLEEAGAKIEIGEDWITLDMEGRRPKAVNIRTAP
YPAFPTDMQAQFTALNSIADGQATIVETVFENRFMHVQEMQRMGANLQIEGNTVVCKGQE
KLTAAPVMATDLRASACLVLAALVADGETQVERIYHIDRGYECIEEKLQQLGARIRRIPT
QARVASNG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggacaaattaatcattaaaggtggtgtcgcgctggatggcgagatccgtatttccggt
gccaaaaatgctgcgttgccgatattgatgggcgcattgttagctgactcgccagttcgt
attggtaatgtgccacatttgcatgacattacaaccacgcttgagttgttaggccgtatg
ggcgtaacactaaccgttgatgaacgttcaggagtattaattgatccttcaacgctgacc
attaccgaagcggcttatgatttggtcaaaaccatgcgggcatcaattctggtgctggga
cctttactggcccgtttcggtaaagcggatgtatcgttaccgggcggctgtgcgattggt
tcgcgtcctgtggatctgcatttgcgtggtctggaacagatgggcgcagaaattaaagtg
gaaaatggttatatccgagccaccagtggtaaaggtctcaagggggcccatatctttatg
gatcaggtcacggtgacaggtactgaaaacctgatgatggcggcaacgctggcgaaaggc
acaaccattatcgaaaatgcggcgcgagagcccgaagtagtcgatttagccaaatacctg
aatcaaatgggcgcgaaaattaccggtgccggttcgacaacgattcagattgaaggagtc
aaaaaactcaacggtacgcactatgcgattcttccggatcgtattgaaaccggcacgtat
ctggttgcagcggcaattacccgtggccgtgtcaaactgaaggataccgacgccaatcag
ttggaagcagtattgctcaagctggaagaggctggagcaaaaattgaaattggtgaggat
tggatcacgctggatatggaaggccgacgtcctaaagcagtgaatatccgaaccgcacct
taccctgcctttccaacggacatgcaggctcagttcactgcgctgaacagtattgcagat
gggcaggccactattgtcgaaaccgtttttgaaaatcgctttatgcatgtgcaggaaatg
cagcgtatgggcgcaaatctgcaaatcgaaggcaacacggtggtgtgcaagggacaggaa
aagctcactgcagcaccggtgatggcaacagatttgcgggcatcagcctgtctggtgctg
gctgctctggtagctgacggagaaacccaggtcgagcgtatttatcacattgatcgtggt
tatgaatgtatagaagaaaaactgcagcaattaggtgcacgtatccgccgtattccgacc
caggcaagggtggcctctaatggctga

DBGET integrated database retrieval system