KEGG   Methylophaga sp. JAM1: Q7A_871Help
Entry
Q7A_871           CDS       T02055                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mej  Methylophaga sp. JAM1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
883819..884634
Genome map
AA seq 271 aa AA seqDB search
MPWSFPGHQLRLPARGCLSADICYAEAVAPLIERSYPNRLIKKHAANTQELPMTFTMNQA
HSNMVWQQVRPNEVSHPEVLKALQQIDRAQFVSDDYKALAYSDTRLPIGCGQFMWTPLEE
GRILQFLQLKPSDSVLEVGTGSGFFTALIAGLSSNVISIEYFAELSALAGSRLEAADIQN
VNLVCGDASHGWKLTDRIDVIVLTASCQQVPEDFLHALKVGGHLVIITGQAPAMQVQRIT
RTGEWLWQTETLFETVVAPMVHAEKKPEFIF
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgccatggtcatttcccggtcatcaacttcgcttgccagctaggggctgtttatcagct
gatatctgctatgcagaagcggttgcaccgcttattgaaaggtcatatcctaaccgattg
ataaaaaaacacgcggcaaacactcaggaattacccatgacattcaccatgaatcaagca
cattccaatatggtttggcaacaagttcgacctaatgaagtttcccatccagaagtactg
aaagcattacagcaaattgatcgggcacaatttgtctctgatgattataaagcgctggcg
tattcagacacgcgtttgccgattggttgtggtcagtttatgtggacaccgctggaagaa
gggcggattttgcaatttttacaattgaagccatcagattcggtgctggaagtcggtacc
ggtagtggtttttttacagcattgatcgccggactgtcatcaaatgtcattagcatagaa
tattttgccgaactgtctgcgttggctggttcacgtttggaagctgcagacatacaaaat
gtaaacctggtgtgtggtgatgcaagtcatggttggaagctgacagatcgcattgatgtt
atcgtcttgacggccagttgccagcaggttccggaagattttcttcatgcgctcaaagta
ggggggcatttagtgattattaccggtcaggcacctgcgatgcaggtacagcgtattact
cgtaccggcgagtggttatggcaaacggagactttatttgaaacggtggtggcacccatg
gtgcatgctgaaaaaaaacctgagtttatcttttaa

DBGET integrated database retrieval system