KEGG   Methylophaga nitratireducenticrescens: Q7A_887Help
Entry
Q7A_887           CDS       T02055                                 

Definition
(GenBank) class II aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej00051  Fructose and mannose metabolism
mej01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Q7A_887
Enzymes [BR:mej01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Q7A_887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AFI83729
UniProt: I1XH60
Position
899104..899670
Genome map
AA seq 188 aa AA seqDB search
MPEPSLTELKTQLVQHYRWLRQYGCNDSHSGNASFRWHNQIWVTPTGCCADTLTSEMLVP
CDIDGHCGEGASLDAPLHLATYQHNPNTRAVIHSHGPHAIAMTMNGEDFIPVDFEGQYYF
STIPVISIDYAEYIEKSPLAVAQGLARHKVVIVRGHGVYACAETINLAYKWSCSVELSAK
TAWLAAQL
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccatcactgacggaacttaaaacccaactggttcaacattatcgttggttg
cgtcaatacgggtgcaatgattcacatagtggtaatgcttcttttcgctggcataatcag
atttgggtgacccctacaggctgttgtgccgataccctgacatcggaaatgctggtgccc
tgtgatattgacggccactgtggggaaggcgcctcactggacgctccgctgcacctggct
acttatcagcataatccgaataccagagccgttattcatagccatgggccgcatgcgatt
gcgatgacgatgaatggtgaagattttatcccggtggattttgaagggcagtattatttt
tcgaccattccggttatttcaattgactatgccgagtacattgagaaatcacctttggca
gtggcgcaggggctggcccgtcataaagttgtcattgttcgtgggcatggtgtctatgcc
tgtgcagaaaccatcaatttggcctacaagtggagttgctcagtcgagctctctgccaaa
acggcctggcttgctgctcagctataa

DBGET integrated database retrieval system