KEGG   Methylophaga nitratireducenticrescens: Q7A_887Help
Entry
Q7A_887           CDS       T02055                                 

Definition
ribulose-5-phosphate 4-epimerase-related epimerase/aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Q7A_887
Enzymes [BR:mej01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Q7A_887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
899119..899685
Genome map
AA seq 188 aa AA seqDB search
MPEPSLTELKTQLVQHYRWLRQYGCNDSHSGNASFRWHNQIWVTPTGCCADTLTSEMLVP
CDIDGHCGEGASLDAPLHLATYQHNPNTRAVIHSHGPHAIAMTMNGEDFIPVDFEGQYYF
STIPVISIDYAEYIEKSPLAVAQGLARHKVVIVRGHGVYACAETINLAYKWSCSVELSAK
TAWLAAQL
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccatcactgacggaacttaaaacccaactggttcaacattatcgttggttg
cgtcaatacgggtgcaatgattcacatagtggtaatgcttcttttcgctggcataatcag
atttgggtgacccctacaggctgttgtgccgataccctgacatcggaaatgctggtgccc
tgtgatattgacggccactgtggggaaggcgcctcactggacgctccgctgcacctggct
acttatcagcataatccgaataccagagccgttattcatagccatgggccgcatgcgatt
gcgatgacgatgaatggtgaagattttatcccggtggattttgaagggcagtattatttt
tcgaccattccggttatttcaattgactatgccgagtacattgagaaatcacctttggca
gtggcgcaggggctggcccgtcataaagttgtcattgttcgtgggcatggtgtctatgcc
tgtgcagaaaccatcaatttggcctacaagtggagttgctcagtcgagctctctgccaaa
acggcctggcttgctgctcagctataa

DBGET integrated database retrieval system