KEGG   Methylophaga sp. JAM1: Q7A_941Help
Entry
Q7A_941           CDS       T02055                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mej  Methylophaga sp. JAM1
Brite
Enzymes [BR:mej01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Q7A_941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(952577..953332)
Genome map
AA seq 251 aa AA seqDB search
MNMGYISSTATGILLLILWSIGLSPNLVLAADDFQQQREGLIEQIRDDVRTSSVVLGKSR
LDDNVLKAMATVPRHEFVPEKHRHQSYRNRPLPIGYGQTISQPAIVAMMTDLLQLESTDK
ALEIGTGSGYQAAILAELVEQVFSIEIVPELAERAAVDLERTGYLNVTTREGDGYFGWEE
EAPFDAIIVTAASDHIPPPLLKQLKPGGRMVIPVGSRFMVQHLVLVTKDADDNIVTEQLL
PVRFVPLTSQR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgggatatatatccagtacggcgactggtatcttgttgttgattctatggtct
atcgggctgagtccaaatttagtgctcgcggcagacgatttccagcagcaacgtgaagga
ctgattgaacaaattcgggatgatgtgcgtaccagcagtgtcgtcctgggcaaatcccgg
ctcgatgacaacgtattaaaagccatggcaactgtgccacgacacgagtttgttccagaa
aagcaccgacatcaatcgtaccgtaacagacctcttccaataggttacggtcagacaatt
tcccagccagccatcgtggcgatgatgacagatctgttgcagcttgagtcaacagataag
gcattggaaattggcaccggttccggttatcaggcggcaatactggctgaattggtagaa
caggtattcagtatcgagatcgtacctgaactggccgagcgggcggccgttgatttagag
cgtaccggttatctcaatgtcaccacgcgtgaaggcgatggctacttcggctgggaagaa
gaagccccgtttgatgccatcattgttacggcggcgagcgatcatattccacccccgtta
ctgaagcagctcaaacccggtggccgcatggtgattccggttggcagccgatttatggtg
cagcatctggtgctggtcaccaaagacgctgacgataatatcgtgacagagcaattgctg
ccggtacgctttgtaccgctgaccagccagcgctga

DBGET integrated database retrieval system