KEGG   Methanobacterium lacus: Metbo_0070Help
Entry
Metbo_0070        CDS       T01437                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mel  Methanobacterium lacus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metbo_0070
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metbo_0070
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metbo_0070
Enzymes [BR:mel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Metbo_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
66190..67482
Genome map
AA seq 430 aa AA seqDB search
MYKITLSEKETPKKWYNIAADLPVELPPSTQTEEGHQIDNLPKLFSKYVLQQEMSTERWI
DIPKEVRKVYKQIGRPSALFRATGLEKYLDTPAKIYYKREDQSPVGSHKLNTAIAQAYYA
KKAGAERLTTETGAGQWGSALSLACSLLGLDCTVYMVNVSFKQKPYRKTVMHLYDGEVLP
SPSNRTEFGRKILAEDPNHPGSLGIAISEAMEDAFNDDSAFYTLGSVLNHVLLHQTVIGL
EAQKQFAKIDEKPDILVGCVGGGSNFGGAAFPFMKDKLSGDLDCQFLAAEPASCPTLTQG
EYKYDYGDTAGLTPLMKMYTLGHEFVPPSVHAGGLRYHGMAPLVALLVNQGLVEGRTVNQ
TELFQAGKLFANTEGVIPAPETCHAIKVAIDEANKCKKTGEEKNIMITFSGHGLLDLQGY
DDFIEGHLTQ
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaataactctttcagaaaaggaaacaccgaaaaaatggtacaatatagctgca
gatcttcctgtggaacttcccccatcaacacaaacagaggaaggccatcaaattgacaat
ttgccaaaattattttctaagtatgttcttcaacaggaaatgtccacagaaagatggata
gacattccaaaagaagttaggaaagtttacaaacagattggaagaccttctgccctcttc
agagctacaggactcgaaaagtacctagatactcctgcaaaaatttactacaaacgtgaa
gatcagtcccctgtgggcagtcacaaactcaataccgcaattgcacaggcatactacgct
aaaaaagcaggtgctgaaagattaaccaccgaaactggtgcaggacaatggggatcagca
ttatccctggcatgttcattgttaggattggattgtaccgtctacatggtaaacgtttca
ttcaaacaaaaaccataccgtaaaactgtaatgcacttatacgatggcgaagtactccct
tcccctagtaacagaacagaattcggaagaaaaattctagcagaagatccaaaccatcca
ggatcccttggaatagcaatttcagaagctatggaagatgccttcaacgatgatagtgca
ttttatactctcggcagtgtattaaaccatgttctactccatcagacagtgattggtctt
gaagctcaaaaacagttcgctaaaattgatgaaaaaccagatatcctagttggatgtgtt
ggaggaggaagtaactttggtggagcagctttcccattcatgaaagacaaactctccgga
gacctagactgccagttcctagctgcagagcctgcttcctgtccaaccttaacacagggg
gagtacaaatacgattacggtgacactgcaggattaactcccctcatgaagatgtacaca
ttgggtcatgaatttgtcccaccatcagtgcatgcaggaggattaagataccacggaatg
gcacctttagtggcattactagttaaccaaggacttgtcgaaggaagaactgtaaaccag
acagaattattccaagcaggtaagctatttgccaatacagaaggagtcatacctgcacct
gaaacctgtcacgccataaaagtcgcaatagatgaagcaaataaatgcaaaaagactgga
gaagaaaagaatatcatgatcactttctctggccatggtctattggatcttcagggatac
gacgacttcatagagggacacttaacacagtaa

DBGET integrated database retrieval system