KEGG   Methanobacterium lacus: Metbo_0114Help
Entry
Metbo_0114        CDS       T01437                                 

Definition
(GenBank) L-fuculose-phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mel  Methanobacterium lacus
Pathway
mel00051  Fructose and mannose metabolism
mel01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Metbo_0114
Enzymes [BR:mel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Metbo_0114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ADZ08367
JGI: Metbo_0114
UniProt: F0T7D8
Position
complement(116741..117328)
Genome map
AA seq 195 aa AA seqDB search
MDHETVVKNMVETSHVLYNKGLVPGKSGNISVKFVKDGLNVVAVTPSGSSFKTLKETDIV
LVDLEGNIVSNTNHVPTSELEMHLNIYKVRNDVGAVVHTHSPITTGFAFSDEKIRRFEGF
GPIEEEFLKVVDYHPPGSSDLANTVSEGLLNQDVVVLKDHGMVAVGKNLDEATLLAEFVE
DSAKIQFVKKMLMSN
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggatcatgaaacagtagttaaaaatatggttgaaacttcccatgtactctataacaag
ggactcgttcctggtaagtcaggaaatataagtgtgaagtttgtgaaagatggtttgaat
gttgttgctgttacccccagtggatcttcttttaaaactttgaaagaaacagacatagtt
ctggttgatctcgagggaaatattgtatcaaatacaaatcatgttccaacttcagaatta
gagatgcacctaaatatttacaaagtaaggaatgatgttggtgctgttgtacatacccat
tctccaataacaacgggttttgcattttctgatgaaaaaattagaagatttgaaggtttt
ggccctattgaggaagaatttctaaaagttgtggactaccatccgcctggaagttctgat
ctggcaaacactgtttcagaaggtttgttgaatcaggatgttgttgtgttaaaagaccat
ggaatggtagcagtgggtaaaaatttagatgaggcaactctccttgctgaatttgtagaa
gatagtgccaaaattcaatttgtaaaaaaaatgttaatgtctaattga

DBGET integrated database retrieval system