KEGG   Methanobacterium sp. AL-21: Metbo_0126Help
Entry
Metbo_0126        CDS       T01437                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mel  Methanobacterium sp. AL-21
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mel00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(128030..128950)
Genome map
AA seq 306 aa AA seqDB search
MNFNDIESRFPYIGVSTFYGYPNSKDLNETDVAIVGVPFDHGTTNRPGARFGPRSIRTAS
QNYGIYLNEFGAFDSELKRNILGGVNIVDYGDVPILPTHTKTNMKMINSTFKKIVDAGVF
PVAFGGDHTVTYPIVKAFKKPLDIVHFDTHLDFVDGTENLKFSHSNPLKRVSEIENINNI
TQIGIRGFTDKIENYDESKNYGSKIITASEVMDRGTAWVLDQIPESDNIYVTLDIDVLDP
SIAPGTGTPEPGGLTYNQLKDILTNLTNKGEILGFDLVEVNPLFDLSEITSLTAARLCFD
FLGSIF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaattttaacgatattgaatccagatttccatacataggagtgtccactttttatggt
tatcccaactctaaagatttgaatgaaacagatgttgctattgtgggtgttccctttgat
catggtaccaccaatagacctggagctcgtttcgggccaagatcaattcgtacagcttca
cagaactatggaatttatctcaatgagtttggtgcgttcgattctgaactaaaacgtaat
atacttggcggggttaatattgtggactatggagatgttcccatactgccaacccacaca
aaaactaacatgaagatgataaacagcaccttcaagaaaattgtggatgcgggtgtgttt
ccagttgcatttggaggggatcatactgtcacctatcctattgtaaaggccttcaaaaaa
ccattggacatagttcatttcgatacccatttagattttgttgatggtactgaaaacttg
aaattctcacactccaaccctttaaaaagggtttctgaaatagagaacatcaataacatc
acccagataggaataagaggattcacagataaaatagaaaattatgatgaatccaaaaac
tatggatccaagatcatcaccgcctctgaagtaatggacaggggaacagcatgggttctt
gaccagattcctgaatcagataatatttatgttaccctagatatcgatgttttagatccg
tcgatagcccctggaactggaacaccagaacctggaggattaacttacaaccaattaaag
gatatattaaccaatttaacgaataagggagagattttaggttttgatttggtggaagtg
aatccattgtttgatctgtctgaaataacatctttaactgctgcaagattgtgttttgat
ttcctaggttctatcttctaa

DBGET integrated database retrieval system