KEGG   Methanobacterium lacus: Metbo_0489Help
Entry
Metbo_0489        CDS       T01437                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mel  Methanobacterium lacus
Pathway
mel00010  Glycolysis / Gluconeogenesis
mel00020  Citrate cycle (TCA cycle)
mel00620  Pyruvate metabolism
mel00633  Nitrotoluene degradation
mel00640  Propanoate metabolism
mel00650  Butanoate metabolism
mel00680  Methane metabolism
mel00720  Carbon fixation pathways in prokaryotes
mel01100  Metabolic pathways
mel01120  Microbial metabolism in diverse environments
mel01130  Biosynthesis of antibiotics
mel01200  Carbon metabolism
Module
mel_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mel_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metbo_0489
   00020 Citrate cycle (TCA cycle)
    Metbo_0489
   00620 Pyruvate metabolism
    Metbo_0489
   00640 Propanoate metabolism
    Metbo_0489
   00650 Butanoate metabolism
    Metbo_0489
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metbo_0489
   00680 Methane metabolism
    Metbo_0489
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metbo_0489
Enzymes [BR:mel01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metbo_0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_2 Fer4_9 Fer4_6 Fer4_21 Fer4_16 Fer4_7 Fer4_10 Fer4_17 Fer4_8 Fer4_13 Fer4_18 Fer4_4 Fer4_22 Fer4_15 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADZ08741
JGI: Metbo_0489
UniProt: F0T9J3
Position
complement(467905..468147)
Genome map
AA seq 80 aa AA seqDB search
MVAIGAAVKEPGSTRKNKTGSWRTFKPILDKETCIDCENCVMFCPEGCIDKNYDIDYDYC
KGCGICAEECPVKAIKMERE
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atggtagcaataggagcagctgttaaggaaccgggaagtacccgtaaaaataaaacaggt
agctggagaacattcaaacctattctcgataaggaaacgtgtattgactgcgagaattgt
gttatgttctgtcctgaaggatgtattgataaaaactacgatatagactacgattactgt
aaaggatgcggaatatgcgcagaagagtgtccagttaaggcaataaaaatggagagggaa
taa

DBGET integrated database retrieval system