KEGG   Methanobacterium sp. AL-21: Metbo_0582Help
Entry
Metbo_0582        CDS       T01437                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mel  Methanobacterium sp. AL-21
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metbo_0582
   01230 Biosynthesis of amino acids
    Metbo_0582
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metbo_0582
   00030 Pentose phosphate pathway
    Metbo_0582
   00051 Fructose and mannose metabolism
    Metbo_0582
  Energy metabolism
   00680 Methane metabolism
    Metbo_0582
Enzymes [BR:mel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Metbo_0582
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Metbo_0582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
569360..570457
Genome map
AA seq 365 aa AA seqDB search
MKTTISVIKADVGSIAGHAKTHVALKNKCDEVLAKAKESELLVDYHITSCGDDIDLIMTH
RNGEENEEVHELAWNAFLEATQVAKSLKLYGAGQDLLSDTFSGNIKGMGPGCAEMEFKER
PSDPVIIFCCDKTEPGAFNMPLFKMFADPFNTAGLVIDPSLHGGYDFEIFDVIEHKKVTM
SCPDEMYDALALLGSTGRYVIKHISRRSDNEIAASVSTERLNLMAGQYIGKDDPVAVVRA
QSGFPAAGEVVEPFAFPHLVSGWMRGSHNGPLMPVAQRNANPVRFDGPPRVIALGFQINN
SELVGPLDMFDDPAFDRSRDLASEVAEYMRRHGPFEPHRLPADEMEYTSLPGVLKMLEDR
MEDMD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactactattagtgtaattaaagcagatgttggtagtatagcaggacatgcaaaa
actcatgtcgctttaaaaaataaatgtgacgaggtactagctaaagcaaaagaatcagaa
cttcttgtggactatcatataaccagttgtggtgatgatatagacttgatcatgacccac
agaaacggtgaagaaaatgaagaagttcatgaactagcatggaacgcatttttagaagct
actcaagtagcaaaaagccttaaactctatggtgcaggccaagaccttctttcagacact
ttctcaggtaacattaagggcatgggtcctggatgtgctgaaatggaatttaaagaaaga
ccatctgaccctgtgattattttctgttgtgataaaacagaaccaggtgcatttaacatg
cctctctttaagatgtttgctgacccattcaacacagcaggacttgtaatagacccttcc
ctacacggaggttatgactttgaaatattcgatgtaatcgaacacaaaaaagttaccatg
tcctgtccagatgaaatgtacgatgcattagcactactcggatcaacaggaagatatgta
attaaacacatctcaagaagaagtgacaatgaaatcgcagcttcagtaagtacagaaaga
ttaaaccttatggcaggccagtatataggtaaagatgaccctgtggcagttgtaagagca
caatcaggattcccggcagctggagaagttgtggaaccattcgcattcccacacctagta
agtggatggatgagaggttcacataacggtcctttaatgcccgtagcccagagaaatgct
aatcctgtcagatttgatggaccaccacgtgtaatagcacttggattccaaataaacaat
tctgaacttgtgggaccattagacatgtttgatgatccagcatttgacagatcaagggat
cttgcatcagaggtggcagagtacatgagaagacatggaccattcgaaccacacagatta
cctgctgacgaaatggaatacaccagtcttccaggtgttctaaagatgctagaagacaga
atggaagacatggattaa

DBGET integrated database retrieval system