KEGG   Methanobacterium lacus: Metbo_0582Help
Entry
Metbo_0582        CDS       T01437                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mel  Methanobacterium lacus
Pathway
mel00010  Glycolysis / Gluconeogenesis
mel00030  Pentose phosphate pathway
mel00051  Fructose and mannose metabolism
mel00680  Methane metabolism
mel01100  Metabolic pathways
mel01110  Biosynthesis of secondary metabolites
mel01120  Microbial metabolism in diverse environments
mel01130  Biosynthesis of antibiotics
mel01200  Carbon metabolism
mel01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metbo_0582
   00030 Pentose phosphate pathway
    Metbo_0582
   00051 Fructose and mannose metabolism
    Metbo_0582
  Energy metabolism
   00680 Methane metabolism
    Metbo_0582
Enzymes [BR:mel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Metbo_0582
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Metbo_0582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ADZ08833
JGI: Metbo_0582
UniProt: F0TA10
Position
569360..570457
Genome map
AA seq 365 aa AA seqDB search
MKTTISVIKADVGSIAGHAKTHVALKNKCDEVLAKAKESELLVDYHITSCGDDIDLIMTH
RNGEENEEVHELAWNAFLEATQVAKSLKLYGAGQDLLSDTFSGNIKGMGPGCAEMEFKER
PSDPVIIFCCDKTEPGAFNMPLFKMFADPFNTAGLVIDPSLHGGYDFEIFDVIEHKKVTM
SCPDEMYDALALLGSTGRYVIKHISRRSDNEIAASVSTERLNLMAGQYIGKDDPVAVVRA
QSGFPAAGEVVEPFAFPHLVSGWMRGSHNGPLMPVAQRNANPVRFDGPPRVIALGFQINN
SELVGPLDMFDDPAFDRSRDLASEVAEYMRRHGPFEPHRLPADEMEYTSLPGVLKMLEDR
MEDMD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactactattagtgtaattaaagcagatgttggtagtatagcaggacatgcaaaa
actcatgtcgctttaaaaaataaatgtgacgaggtactagctaaagcaaaagaatcagaa
cttcttgtggactatcatataaccagttgtggtgatgatatagacttgatcatgacccac
agaaacggtgaagaaaatgaagaagttcatgaactagcatggaacgcatttttagaagct
actcaagtagcaaaaagccttaaactctatggtgcaggccaagaccttctttcagacact
ttctcaggtaacattaagggcatgggtcctggatgtgctgaaatggaatttaaagaaaga
ccatctgaccctgtgattattttctgttgtgataaaacagaaccaggtgcatttaacatg
cctctctttaagatgtttgctgacccattcaacacagcaggacttgtaatagacccttcc
ctacacggaggttatgactttgaaatattcgatgtaatcgaacacaaaaaagttaccatg
tcctgtccagatgaaatgtacgatgcattagcactactcggatcaacaggaagatatgta
attaaacacatctcaagaagaagtgacaatgaaatcgcagcttcagtaagtacagaaaga
ttaaaccttatggcaggccagtatataggtaaagatgaccctgtggcagttgtaagagca
caatcaggattcccggcagctggagaagttgtggaaccattcgcattcccacacctagta
agtggatggatgagaggttcacataacggtcctttaatgcccgtagcccagagaaatgct
aatcctgtcagatttgatggaccaccacgtgtaatagcacttggattccaaataaacaat
tctgaacttgtgggaccattagacatgtttgatgatccagcatttgacagatcaagggat
cttgcatcagaggtggcagagtacatgagaagacatggaccattcgaaccacacagatta
cctgctgacgaaatggaatacaccagtcttccaggtgttctaaagatgctagaagacaga
atggaagacatggattaa

DBGET integrated database retrieval system