KEGG   Methanobacterium lacus: Metbo_0613Help
Entry
Metbo_0613        CDS       T01437                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mel  Methanobacterium lacus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metbo_0613
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metbo_0613
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Metbo_0613
Enzymes [BR:mel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Metbo_0613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(592985..594184)
Genome map
AA seq 399 aa AA seqDB search
MMKCISCGEEYEIDEIIYTCKKCDSTLEVVSSHPDISKDIFSCRKSTMWKYKEFLPVDET
KIVSLEEGGTPFCKCDKLGSELGIDLYVKVEGSNPTGSFKDRGMSVGMTKAVELGVNTVG
CASTGNTSASLAAYAARAGKRCIVLLPAGKVALGKLAQAMFHGAEVISIRGNFDEALETV
TSLALEGQLYLLNSVNPYRLEGQKTIGFEIVDDLGWKSPDRIVLPVGNAGNISAIWKGIK
EFHEAGFMDDLPMMTGIQAEMSAPITNAVRQGKNTIEPVKDPETIATAIRIGAPVSAQKA
LRAIYESNGYADTVTDDEILSAQKLLARKEGIGVEPASAASIAGLLKMVESGEVDKGEQV
VCIVTGHLLKDPNTAIDACVEPLEIDADVKTLSKIINKQ
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagtgtatatcgtgtggagaagaatacgaaattgatgaaataatttacacctgt
aaaaaatgtgattccacacttgaagtggtttccagccatccagatatttctaaagatatt
ttcagctgcagaaaatccaccatgtggaagtataaggaatttttaccagttgatgaaaca
aaaattgtcagcctagaagagggaggcacccccttctgtaaatgtgataaactagggtcc
gaacttggaatagatctgtatgttaaggttgaaggttcaaaccccactggaagttttaaa
gacaggggaatgagtgtaggtatgacaaaggctgttgaacttggagttaatacagtagga
tgtgcttcaacagggaatacatctgcttcactcgcagcctacgcagctagagctggtaaa
agatgcatcgtgctcttacctgcagggaaagttgcacttggaaaacttgcacaggcaatg
tttcatggtgctgaagttatctcaatacgtggaaacttcgatgaagcacttgaaacagtc
acatcattagcactggaaggacagctttaccttttaaattctgttaacccctaccgttta
gaaggccaaaaaaccataggatttgagatcgtagatgatctgggttggaagtctccagac
aggatagtgttacctgtgggtaatgcaggaaacatttcagctatatggaagggaattaaa
gaatttcatgaggcaggattcatggatgatcttccaatgatgactggaatacaggctgaa
atgtcagcaccaataaccaatgctgttcgccaaggcaaaaataccatagaaccagttaag
gatcctgaaacaattgcaactgcaataagaataggtgcacctgtaagtgcacagaaggca
ttgcgggccatatatgaatcaaacggttatgctgatacagtcacagatgatgaaatattg
agtgctcagaaattactggcaagaaaagagggaattggagtagaacctgcgtctgcagca
tcaattgctggccttttaaagatggttgaatctggtgaagtagacaaaggcgaacaggtc
gtttgtattgtgacaggtcacctgttaaaagaccctaatactgcaatagatgcctgtgta
gaacctttggaaattgatgctgatgttaaaactctttcaaagattattaacaagcaatga

DBGET integrated database retrieval system