KEGG   Methanobacterium lacus: Metbo_0658Help
Entry
Metbo_0658        CDS       T01437                                 

Definition
(GenBank) PfkB domain protein
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
mel  Methanobacterium lacus
Pathway
mel00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Metbo_0658
Enzymes [BR:mel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Metbo_0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF865
Motif
Other DBs
NCBI-ProteinID: ADZ08909
JGI: Metbo_0658
UniProt: F0TAF7
Position
633684..634556
Genome map
AA seq 290 aa AA seqDB search
MNQLDVLALGTCNIDFLMNVPRFAVADDEVDTEKLNVTLGGSAANFALKTSDLGLKTGIM
ARIGKDNFGNYIRSNFKEKNINTERLITIDEKTGMAFIAVDQVGERSIYTYMGANSKFEL
LKPDINLIKNSEILHLTGMYIEVVEEASKHANTLSFNPGALLASFGMKAMEDVLSRTDIL
FLNEKEVGLLTGENCPSGAKLLVEAGVKMVVVTLGKAGSKLFTMDHEIHQPSNMVKPVDT
TGAGDSFAAGFINGFLRNRNLPNCLKDGNNSAFDCLTKFGASDTDLFKLK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaattggatgttttagcccttggtacttgtaacattgattttctgatgaacgtg
cccagatttgcagttgcagatgatgaggtggacactgaaaaactcaatgtaaccttagga
ggatctgctgctaactttgcattgaaaacttccgatttaggattaaaaactgggatcatg
gccagaattggtaaagataattttggaaattacattcgttccaatttcaaagaaaaaaat
atcaacacagaaaggctcattacaatagatgaaaagacaggaatggcatttatagcagtg
gaccaagtgggagaacgatccatatacacatatatgggggcaaattcaaaatttgaacta
ttaaaacctgatattaatctcattaaaaactctgaaatactacatttaacaggcatgtac
atagaagttgtggaagaagcctcaaaacatgctaatacattatcattcaatcccggtgct
ctgcttgcttcctttggaatgaaagcaatggaagatgtactgtccagaaccgatatccta
tttttaaatgagaaagaagtcggtcttttaactggtgaaaactgtccttcaggagctaag
cttctggttgaagcaggtgttaaaatggtggtggtgacactgggaaaagcaggatcaaaa
ctcttcacaatggatcatgaaattcatcaaccatcaaacatggttaaaccagttgataca
actggagctggagattcatttgcagcagggtttatcaatggatttttaagaaatagaaac
cttccaaattgtctaaaagatggcaataattctgcttttgattgtttaaccaaatttgga
gcgtcggataccgatctatttaaattaaaataa

DBGET integrated database retrieval system