KEGG   Methanobacterium lacus: Metbo_0846Help
Entry
Metbo_0846        CDS       T01437                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mel  Methanobacterium lacus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Metbo_0846
Enzymes [BR:mel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Metbo_0846
Peptidases [BR:mel01002]
 Cysteine Peptidases
  Family C44
   Metbo_0846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
806126..807991
Genome map
AA seq 621 aa AA seqDB search
MSAITGIFNRNGKNIKLSQFQKMNSKLSHRGRGNSKNWIEGNMALGHQMLWTTKESLIEE
LPFHDEDLKLIITSDARIDNREELSNILNIENSTEVSDSYYILKSYEKWGENCPKHLLGD
FSFAIWDDSQQKLFCARDHMGIKPFYYFLSNDVFIFGTEIKAIIDNDYVPYELNEYKLAL
FLMKDTENNKLTFYKDIFELPGGHSIVLNKSEFDISCYWQLDPNLEIIMDSEEDYVKKFL
ELFEESVKCRLRSCFPVGSELSGGLDSSSIVSVAKNIRGANDCFQPFCTFSQIFEETLEC
DEKNYINTLIDDTIEPFFINVDNISPLNDIDTILWYQDQPFYTPHITKQIQLYKHVQDRG
VHVLLSGQGGDQVLSLGNNYFKELAVTNQWKMLINEINDFSKMINTNRFTVFKEKVIYLL
LPYKLKKFIKIFLGINDESIINLEFAQSLGFDLKNYYNHLNDVNKLNTKEIHYKKITSSV
NETVFGTIDRRVANFGIEVRFPFYDKRLVEFCYAIPNEMKFKNGWNRYILREAMKNIMPD
EIRERVDKNNFSKSFEKSFIKYEFNYIQNILKNDKLIRNYVNLELFNSCRIDRFKESDFF
DLWIIILISIWLNQFKKRFNI
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccataactggaatttttaacaggaatggaaaaaatattaaattgtcacaattt
caaaaaatgaatagtaaattgtcacatagaggcaggggtaactcgaaaaattggattgaa
gggaatatggcattgggtcatcaaatgttatggaccactaaagaatctttaatagaagaa
ttgccatttcatgatgaagatttaaaattgattataacttcggatgcaagaattgacaat
agagaagagctttcaaatatattaaacattgaaaacagtactgaagtatcggacagttat
tatatactaaaatcttatgaaaaatggggagaaaattgccccaaacatttacttggagat
ttttcatttgcgatttgggatgattctcaacaaaaattattttgtgctagagatcatatg
ggaataaaacctttctattattttttaagcaatgatgtattcatttttggtactgaaata
aaggctataattgacaatgattatgttccatatgaattaaatgaatataagttagctctt
tttttaatgaaagatactgagaataataaactaactttttataaagatatatttgaattg
cctggaggacattctattgttctaaataaatcagaatttgatatttcatgttactggcaa
ttggatcctaatttagagataataatggattctgaagaggattatgtaaaaaaattttta
gaattatttgaagaatctgttaaatgtagattaagaagctgttttccagttggtagtgaa
ttaagtgggggattagattcttcttctattgttagtgttgctaaaaatattaggggtgca
aacgattgttttcaaccattttgtactttttcacaaatttttgaagaaactttagaatgt
gatgaaaagaattatataaatacattaattgatgatacaatagaacctttttttatcaat
gtagataatattagtcccctaaatgacattgacacaatattatggtatcaagatcaacct
ttctatacaccacatataacaaaacagatccaattatataaacatgtacaagatcgagga
gtacatgttcttttaagtggtcaaggaggagatcaggttttatcattaggaaataattat
tttaaagaattagcagttacaaatcaatggaaaatgttaataaatgaaattaatgacttt
tctaaaatgataaatacaaatcgattcactgtatttaaagaaaaagttatttatttgttg
ttaccttataaattgaaaaagtttatcaaaatatttttagggataaatgatgaaagtatt
attaatttagagtttgcacagagtctaggatttgatttgaaaaattattataatcaccta
aatgatgttaataagttaaacactaaagaaatacattacaaaaaaattacaagttcggta
aatgaaacagtgtttggaacaatagatcgtcgagttgctaattttggtattgaagttcga
tttcctttttatgataagaggcttgttgaattttgttatgcaataccaaatgagatgaaa
ttcaaaaatggttggaatagatatattctaagagaagcaatgaaaaatattatgcctgat
gaaattagagagcgggttgataaaaacaattttagtaagagttttgaaaaaagtttcatc
aaatatgaatttaattatatacaaaatattctaaaaaatgacaaattgataaggaattat
gttaatttagaattatttaattcttgtagaattgatagatttaaagagagcgattttttt
gatctttggatcataatattgatcagtatatggttgaatcagtttaaaaaacgttttaat
atctaa

DBGET integrated database retrieval system