KEGG   Methanobacterium lacus: Metbo_1083Help
Entry
Metbo_1083        CDS       T01437                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mel  Methanobacterium lacus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metbo_1083
Enzymes [BR:mel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Metbo_1083
Exosome [BR:mel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Metbo_1083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1081391..1082362)
Genome map
AA seq 323 aa AA seqDB search
MEFPVTRMRRLRKDQNIRNILTETKLNPEDFIYPIFINEALEDGNKEEIKTMPGQFRFSI
NDAVTYLKELESIGLSSVILFGMPEIKDEKGSMAYHKNGVIQQTIRKLKAETDLVVITDV
CLCEYTSHGHCGIIKDGEVLNDPTLNYLSKVALSHAEAGADIVAPSDMMDGRVASIRKVL
DLNGYQDTIIMSYSAKYASAFYAPFREAVCSTPSFGDRKTYQMNPANSQEALREVKLDIA
EGADMIIVKPAMPYMDIIREVKDEFKMPTVAYQVSGEYSMIMAGIENGYLTQDSIYESLL
SIKRSGADLIISYFAPEFLEGKI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaatttccagtaactagaatgaggagactcagaaaggatcaaaatatcagaaatatt
cttacagaaactaaattaaatccagaagatttcatataccctatttttattaatgaagca
cttgaagacggcaacaaggaagaaataaaaaccatgccgggccagttcagattttcaata
aacgatgctgttacctaccttaaagaacttgaatcaattggattatcatctgttatcctg
tttggaatgccagaaattaaagatgaaaagggatcaatggcgtatcataaaaatggtgtg
atacaacaaacaattcgaaaactaaaggcagaaacagacttggttgttattacagatgtg
tgtctttgtgagtacacctcccatggtcactgcggaatcatcaaagatggggaagtttta
aacgaccctactttaaactacctatcaaaagttgctttaagccatgctgaagcaggagct
gatattgttgcaccatccgatatgatggatggtagagtagcaagcatcagaaaagtatta
gacctcaacggttaccaagacaccataatcatgtcttactcagccaagtacgcctcagct
ttttacgcaccattcagagaggctgtttgttcaacacctagttttggtgacaggaaaact
tatcaaatgaaccctgcaaattcccaggaagccctgagagaggttaaactagacatagct
gaaggggcggacatgataatagttaaacctgcaatgccatacatggatattataagagaa
gttaaagatgaatttaaaatgcccacagtagcatatcaagttagtggagagtactccatg
attatggctggaattgaaaatggatatctcacacaagattcaatttatgaatctttactg
tcaattaaaagatccggggcggacctcatcatcagttactttgctcctgaatttttagag
ggaaaaatttaa

DBGET integrated database retrieval system