KEGG   Methanobacterium lacus: Metbo_1148Help
Entry
Metbo_1148        CDS       T01437                                 

Definition
(GenBank) Cellulase
Organism
mel  Methanobacterium lacus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1153574..1154599)
Genome map
AA seq 341 aa AA seqDB search
MDSLLKKLSDAPGVSGFEEEIREIIIDELKDHVDEVEVDQMGNVITTRKGKPNGKKIMLA
AHMDEIGLMIRYIDKNGFIKFSKIGGINDQMLLNQEVTIHTDDGEVTGVIGSKPPHRMKE
SERKKILDYENMFIDIGAKTKEEAEERVKLGDPITIKQEFTKLGNFYKGKALDNRIGCAI
MIEVMKRAETDATLYGVGTVQEEVGLKGAKTSAFKLNPDMALALDVTIAGDHPGIKEEDA
PAKMGKGPAVILVDASGRGLITHPMVKKLIITAGNEDVIPYQLEVSEGGTTDATAIHLTR
EGIPTGVISPPTRYIHTPVSVVDMEDVENAVNLILAVLKRL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggacagtttgctaaaaaaactttcagatgcaccaggagtttctggatttgaagaagaa
attagagagataataatagatgagttgaaggatcatgttgacgaagtagaagttgatcag
atgggcaacgtgatcaccacccgtaaaggaaagccaaacggtaaaaagatcatgttagca
gctcacatggacgaaattgggcttatgatacgttacatcgataaaaatggtttcattaaa
ttttccaaaattggtggaataaatgatcaaatgcttctaaatcaagaagtaaccatccat
acagatgatggagaagtaacaggagtcataggttcaaagccaccacaccgtatgaaagaa
tcagagaggaaaaaaattctcgattatgaaaatatgttcatagatattggtgctaaaact
aaggaagaagctgaagaacgtgttaaactgggagatccaataacgatcaaacaggagttc
acaaaacttggaaacttttacaagggcaaggcattagacaacagaataggatgcgccatc
atgatcgaagtcatgaaaagagccgaaactgacgcaactctctacggtgttggaacagtt
caagaagaggttggactcaagggagccaaaacatcggcattcaaattaaacccagatatg
gccttggcattagacgttacaatagcaggagaccatcccggaattaaagaagaagatgca
cctgctaaaatggggaagggccccgcagtaatattggtggacgctagtggtagaggactt
attacacacccaatggtaaaaaagctcattataacagcgggaaatgaagatgttatacca
tatcagcttgaagttagcgaaggtggaacaaccgatgcaactgccatacatctcacccgt
gagggaataccaaccggagtcatttcaccaccaacaaggtacatacacacaccagtaagt
gttgtagatatggaagacgttgaaaatgctgtaaatcttatattagcagtgttaaaacga
ctttaa

DBGET integrated database retrieval system