KEGG   Methanobacterium sp. AL-21: Metbo_1148Help
Entry
Metbo_1148        CDS       T01437                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mel  Methanobacterium sp. AL-21
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Metbo_1148
Enzymes [BR:mel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Metbo_1148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1153574..1154599)
Genome map
AA seq 341 aa AA seqDB search
MDSLLKKLSDAPGVSGFEEEIREIIIDELKDHVDEVEVDQMGNVITTRKGKPNGKKIMLA
AHMDEIGLMIRYIDKNGFIKFSKIGGINDQMLLNQEVTIHTDDGEVTGVIGSKPPHRMKE
SERKKILDYENMFIDIGAKTKEEAEERVKLGDPITIKQEFTKLGNFYKGKALDNRIGCAI
MIEVMKRAETDATLYGVGTVQEEVGLKGAKTSAFKLNPDMALALDVTIAGDHPGIKEEDA
PAKMGKGPAVILVDASGRGLITHPMVKKLIITAGNEDVIPYQLEVSEGGTTDATAIHLTR
EGIPTGVISPPTRYIHTPVSVVDMEDVENAVNLILAVLKRL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggacagtttgctaaaaaaactttcagatgcaccaggagtttctggatttgaagaagaa
attagagagataataatagatgagttgaaggatcatgttgacgaagtagaagttgatcag
atgggcaacgtgatcaccacccgtaaaggaaagccaaacggtaaaaagatcatgttagca
gctcacatggacgaaattgggcttatgatacgttacatcgataaaaatggtttcattaaa
ttttccaaaattggtggaataaatgatcaaatgcttctaaatcaagaagtaaccatccat
acagatgatggagaagtaacaggagtcataggttcaaagccaccacaccgtatgaaagaa
tcagagaggaaaaaaattctcgattatgaaaatatgttcatagatattggtgctaaaact
aaggaagaagctgaagaacgtgttaaactgggagatccaataacgatcaaacaggagttc
acaaaacttggaaacttttacaagggcaaggcattagacaacagaataggatgcgccatc
atgatcgaagtcatgaaaagagccgaaactgacgcaactctctacggtgttggaacagtt
caagaagaggttggactcaagggagccaaaacatcggcattcaaattaaacccagatatg
gccttggcattagacgttacaatagcaggagaccatcccggaattaaagaagaagatgca
cctgctaaaatggggaagggccccgcagtaatattggtggacgctagtggtagaggactt
attacacacccaatggtaaaaaagctcattataacagcgggaaatgaagatgttatacca
tatcagcttgaagttagcgaaggtggaacaaccgatgcaactgccatacatctcacccgt
gagggaataccaaccggagtcatttcaccaccaacaaggtacatacacacaccagtaagt
gttgtagatatggaagacgttgaaaatgctgtaaatcttatattagcagtgttaaaacga
ctttaa

DBGET integrated database retrieval system