KEGG   Methanobacterium sp. AL-21: Metbo_1327Help
Entry
Metbo_1327        CDS       T01437                                 

Definition
MCP methyltransferase/methylesterase, cheR/cheB (EC:2.1.1.80 3.1.1.61)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
mel  Methanobacterium sp. AL-21
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mel02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mel02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1325512..1328448)
Genome map
AA seq 978 aa AA seqDB search
MTENRDNEHKTSNNSSNILYVGLGASAGGLDALEKLLSNIPEKSGMAFIIVQHMDPTHKS
GLVDILSRYTKLKVQEVEDGVEVIEDHVYIIPPNKDMGILYGKLQLMEPLEPHGLRMPIN
YFFTTLAQDQEVNSVGVILSGFGSDGSIGLKAIKAKGGISIAQDPATAASDGMPNSAINT
GHVDLILAPEEIPSKLLSYKNSSGKIIKKILSTEDEAEQALMKIFILIRNRTGHDFSQYK
KSTIYRRVGRRMNIHQIEEMYQYLRYLQKNPNEIDQLFREFLINVTSFFRDPEAFESFKK
VVSKYIIDKKSELDTLRIWVPGCSSGEEVYSIAIVIQEILEETNEHLEVQIFGTDLDLNS
IKIARSGTYSDIIIKDISPERLKKFFYKNENLYTIKNNVRDTVVFANHNVLKDPPFTNLD
ILTCRNLLIYLETEAQEKVLSKFKYSLKKDGLLFLGPSENIGEFIDTFTVLDKKWKIYRS
IKSNGSRFDFVKNPIFSVEKNSLNIGSSKFDPQETKPGASMNIINTAKNNLVDIFAPPSA
IINNLGEILYIHGRLGKYLEPSPGKARMNILEMAKNGIKLGLSSAIGNAVSNNKETVFES
LKIDDELGENYVKLTVRPINEPDTVQDLFIVSFEPAIPEDKNEDKITLDPLSKSSEHIKA
LENKLKLTTERLNSTIEEMTTSNEELKSANEELQSMNEESQSTNEELETSKEELQSINEE
LTTVNNELQMKIEELSTVNDDMTNLFNSTEIATIFVDNDINIRKFTEESTKLIKLIEYDV
GRPLSDITSQINYPELIEDISQVIKKVAFREKEVNTSKGEWYKVRIMPYKTSKNVIDGAT
ITFVDISNIKNIQEKMQSALNYAEDIINTVQEPLLILDHKLAVTSANQAFYETFKLNKSD
IENMKLDKINDGDWNIQSLLKQLELTLKENIELKDFEFQNNFKDVGHKKIVLNARKIYRG
DIDTELILLSMQNILKDK
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaatagggataacgaacataagaccagtaataattcttcaaacattttatat
gtgggcttgggagcatctgcaggtggtttagatgctcttgaaaaacttttatccaacata
ccagagaagagtggaatggcatttataattgttcaacatatggatcccacacataaaagt
ggtttggtagatattttatcccgttacactaaattaaaggttcaagaagttgaagatgga
gtagaagttatcgaggatcatgtttatattatcccacctaacaaggacatgggaatatta
tatggaaaactacagctcatggaacctcttgaaccacacggacttcgaatgcctattaat
tattttttcacaaccctagctcaagatcaggaggttaatagcgttggtgtaattctttct
gggtttggaagtgacggatccattggattaaaggctataaaggctaagggaggaatatca
attgcacaggatcctgctactgcagcttctgatggaatgcccaacagcgccataaataca
ggccatgtggatcttattttagcacccgaagaaataccaagcaaacttttatcctacaag
aattcatctggaaagatcataaaaaaaatcttgagcacagaagatgaagcagaacaggcc
ctcatgaaaatatttattctcatcaggaataggactgggcacgatttttcacaatacaag
aagagcacaatataccggcgtgtaggacgtcggatgaacatccatcaaatagaagaaatg
taccagtatctcagatacctccagaaaaatcccaacgagatcgatcaattgtttagggaa
tttctcataaatgtaactagtttcttcagagatcctgaagcctttgaatcttttaaaaag
gtagtttcaaagtatattattgataaaaaatctgaactcgacacattaagaatatgggtt
ccgggctgttctagtggggaagaggtttattcaattgcaattgtaatacaggaaatcctt
gaagaaaccaatgaacatttagaggttcaaatattcgggacagatctagatttaaattcc
attaaaattgcacgttctggaacgtactccgacatcatcatcaaggatattagtcctgag
cgtctgaagaaattcttttataagaatgagaatctttacaccatcaaaaataatgttagg
gacacagttgtatttgcaaatcacaatgtacttaaagatcctcccttcacaaatttagat
atcctgacttgtagaaatttgctcatctaccttgaaacagaggctcaggagaaggttctt
tcaaagttcaaatattctttgaaaaaggatggattactctttttgggaccttctgaaaat
attggggagttcatagacactttcacagtcttggataaaaagtggaaaatatatagatca
attaaatccaatggatccaggtttgattttgttaagaatccaatattttcagttgaaaag
aatagtttaaacatcggcagttccaagtttgatcctcaagaaactaaacccggtgcatct
atgaatattattaatacagcaaagaataatttggttgatatatttgcccctccatcggcc
ataataaataatttgggtgaaattttatatattcacggacgcttaggtaaatatttagaa
ccttcaccaggaaaggctcgtatgaacattcttgagatggctaaaaatggtataaaatta
ggtttaagttctgctattgggaatgctgtatcaaataacaaagaaaccgtgtttgaaagc
cttaaaattgatgatgagttgggagaaaattatgtaaaactcacagtaagacctataaat
gaacctgatacagttcaagatttattcatagtttccttcgaacccgcaatacctgaagat
aaaaatgaggacaaaataactctagatccactttctaagagcagtgaacatatcaaagcc
cttgagaataagttgaagttgactacagaacgtttaaacagcaccattgaagagatgacc
acatccaacgaggaacttaaatctgccaatgaagaactccaatccatgaatgaagagtct
caaagcaccaatgaagaattagaaacttccaaagaagagttacaatcaattaatgaagaa
cttaccactgtgaacaatgaactccagatgaaaatcgaggaactctccacagttaacgat
gatatgaccaacttgtttaacagcacagaaatagcaaccatatttgttgataacgatatt
aatatccgaaaattcacagaagaatccacgaaactcataaaattaatcgaatatgatgtt
ggacgtcctctcagcgatataacttcccagataaattaccccgaacttattgaggatata
agtcaggtaattaaaaaagttgccttcagggaaaaagaagttaacacatctaagggagaa
tggtacaaagtaagaatcatgccgtataaaacttctaagaatgttatcgacggtgccacc
attacgtttgtggatataagcaatataaaaaatatacaggaaaaaatgcaatctgcatta
aactatgctgaagatataataaatactgttcaagaaccgctacttatccttgaccataaa
ttggctgtaacatctgcaaatcaagcattttatgagacttttaagttgaataaatccgat
attgaaaatatgaaattggataaaataaatgatggagattggaacattcaatccctctta
aaacagttggaacttactcttaaggaaaatattgaattgaaggattttgaatttcaaaac
aacttcaaggatgtgggtcacaaaaagattgttttaaacgcacggaagatatatcgagga
gatattgacactgaactgatattactatcaatgcagaatattttaaaagataaatga

DBGET integrated database retrieval system