KEGG   Methanobacterium lacus: Metbo_1715Help
Entry
Metbo_1715        CDS       T01437                                 

Definition
(RefSeq) acetate/CoA ligase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mel  Methanobacterium lacus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metbo_1715
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metbo_1715
   00620 Pyruvate metabolism
    Metbo_1715
   00640 Propanoate metabolism
    Metbo_1715
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metbo_1715
   00680 Methane metabolism
    Metbo_1715
Enzymes [BR:mel01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Metbo_1715
Lipid biosynthesis proteins [BR:mel01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Metbo_1715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1761509..1763413
Genome map
AA seq 634 aa AA seqDB search
MKQDTDVLLDEKRVFKPSEEILKLANIKDWEAEIEKGKDIEKYWAEKAEQFVWFKKPEKT
LDESNKPFYKWFVNGKINMAYNAVDRWIDTDKRNQVAILYVNERGHEKKMTYYELYREVN
KFANALKNLGVKKGDRVSTYLPMCTELIVTLLACTKIGAVHSVVYSGLSVGAFVERINDA
EAKILITADGTFRRGKIIDLKKVSDEAILQCPTIETVVVVKHTGIPIEMSELSGREIFYE
TLIEGEPAECEAEEMDAEDPLFLLFTSGSTGKPKGVLHSTAGYMVGTATTLKNAFNIHDG
DLWWCTGDIGWITGHSYLLYGPLLLGTTTLVYEGAPDYPDPGAWWKIVEKYGVTKLYTAP
TAIRHLMRFGNKYTKIYNLSSLKVLGTVGEPINPEAWMWLYENVGKENCPIIDTWWQTET
GMFMIAPLPVTPLKPGSATKALPGVDADVVDENGNSVPPGKGGMLVIKKPWPSMFRTLYK
DEKKYVDNYWKDIPGCVYTAGDIARKDKDGYFWIQGRSDDVLKIAGHRIGTSEVESAFVS
YPAVVEAAVIGKSDPIKGEVIKAFVILKEGYELKTKLIEDLSKHVRYELGPVAVLGQIKQ
VDSLPKTRSGKILRRVLRARDRGEDVGDISTLEE
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
ataaaacaggacactgatgtattgctcgatgaaaaaagggtcttcaaacccagtgaagaa
attttaaaacttgccaacataaaagattgggaagctgaaatagaaaagggaaaagatatc
gaaaaatactgggcagaaaaggctgaacaattcgtttggtttaaaaaacctgaaaaaacc
ctggacgaatctaataaaccgttttacaaatggtttgtaaacggtaaaattaacatggca
tacaacgccgttgatagatggatagatacagacaaacgtaaccaggtagcaattttatac
gtgaatgaacgtggtcatgaaaagaagatgacctactacgaactttacagggaagttaac
aagtttgcaaatgcacttaaaaatttaggtgtgaaaaagggcgaccgtgtttccacctac
cttccaatgtgtaccgaactcattgtaaccttgctcgcatgtaccaagatcggtgcagtt
cacagtgtggtctattcaggactgagtgttggggcatttgttgaaagaataaatgatgct
gaggctaaaattctcataacagcagatggaacatttagaaggggaaaaattatcgacttg
aaaaaggtttcagacgaagcgatactccagtgcccaacaattgaaacagtggtggttgtg
aagcacacaggaattccaattgaaatgtcagaattgagtgggagggaaatcttctacgaa
acactgattgaaggagaaccagcagagtgtgaagcagaagagatggatgctgaagatcca
ctgtttctacttttcacctcgggaagtacaggaaaacctaagggagttcttcacagtact
gcaggttacatggttggaacagccacaacccttaaaaatgcattcaacatacacgatgga
gatctttggtggtgcacaggagatattgggtggataacaggccacagttacctcttatac
ggaccacttctacttggaacaactacactagtctacgagggtgctccagactaccctgat
ccaggtgcatggtggaagatcgttgagaagtatggagtaaccaaactctacacagcacca
acagccataagacatctaatgaggttcggtaataaatacaccaaaatatacaacctttca
tcacttaaggtgcttggaacagtgggagaaccaataaatccagaggcatggatgtggctc
tacgaaaatgtgggtaaagagaattgtccaatcatagacacttggtggcagactgaaact
ggaatgttcatgatagcacccctcccagtcacaccccttaaaccaggatctgcaaccaaa
gcactaccaggtgtcgatgcagatgtggtggatgaaaatggaaattcagtaccacctgga
aagggcggtatgctggttattaaaaaaccatggccatcaatgtttagaacactctacaag
gacgaaaagaaatacgtggataattactggaaagacattccgggctgcgtatacacagca
ggagatatagcaagaaaagataaagatggatacttctggatacagggaagatcagatgat
gtcctgaaaattgcaggtcacagaataggaaccagtgaagttgaatctgcatttgtaagt
tatcctgcagttgtggaagctgctgtcataggtaaatcagacccaattaagggagaagtt
atcaaggcattcgtaattctcaaggaaggttacgaacttaaaaccaaactcatcgaagat
ctaagcaaacacgtaagatacgaactgggacctgtggctgttttaggacagattaaacag
gttgattcacttccaaaaaccagaagcggtaagatcttaagacgggtgcttagggcaagg
gacagaggagaagatgtgggtgatatatcaacgctagaagaataa

DBGET integrated database retrieval system