KEGG   Methanobacterium sp. AL-21: Metbo_1887Help
Entry
Metbo_1887        CDS       T01437                                 

Definition
metallophosphoesterase
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mel  Methanobacterium sp. AL-21
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:mel00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Metbo_1887
Enzymes [BR:mel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Metbo_1887
Protein phosphatases and associated proteins [BR:mel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Metbo_1887
Transcription machinery [BR:mel03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Metbo_1887
Spliceosome [BR:mel03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Metbo_1887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1935286..1936071)
Genome map
AA seq 261 aa AA seqDB search
MGFYRGKLIELPKEGHAIVVTDIHGNLTDYNKYLELWKKYGEKNFHFIITGDFIHAMGKK
DDRSIDILESVMHNFKHCKNFHALLGNHEWSAISMVSVYKGGVNQSHSFIKLLKDRFGNG
WEVKLEEYQNFFKKLPVAVKTDNKLFISHGGPPRRINSIEDIVHITDKGYGEDNNKLYQL
LWNREENFNKEDLNNFLRVVNCNAMIVGHTPVDGVKMVYDKQLVVSSSFSLGKKSYLVIN
LKNNIERARDLLSMENLHWYS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggggttttatagggggaaacttattgaactgccaaaggaaggtcatgcaatcgttgta
actgatattcatggtaacctcacagactacaataaatacttggaattatggaaaaaatat
ggcgaaaaaaatttccattttattataaccggagattttatacatgccatgggtaaaaag
gatgacagatccatcgatatcttggaatctgtgatgcacaactttaaacactgtaaaaat
ttccatgctttactgggtaaccatgaatggtcagcgatctccatggtttcagtgtacaaa
ggtggtgttaatcagtcacacagttttataaagttgttgaaggatcgttttgggaatggt
tgggaagttaaacttgaagagtatcaaaattttttcaaaaaactcccagtagcagttaaa
accgataataaactttttataagtcatggcggccctccaagacgcattaactcaattgaa
gatattgttcacattactgacaagggttacggagaggataataataaactctaccagtta
ctttggaatagggaagaaaacttcaataaagaggatctaaacaattttctgagggtggtt
aactgcaatgccatgatagttggtcacacacctgttgatggtgttaaaatggtgtacgat
aaacagttagtggtttcatccagtttttcactgggtaaaaagtcctatttggttataaat
ctcaagaacaacattgaaagggcaagagatctgcttagcatggaaaatttgcactggtac
agctag

DBGET integrated database retrieval system