KEGG   Methanobacterium lacus: Metbo_1898Help
Entry
Metbo_1898        CDS       T01437                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mel  Methanobacterium lacus
Pathway
mel00010  Glycolysis / Gluconeogenesis
mel00620  Pyruvate metabolism
mel00640  Propanoate metabolism
mel00680  Methane metabolism
mel00720  Carbon fixation pathways in prokaryotes
mel01100  Metabolic pathways
mel01110  Biosynthesis of secondary metabolites
mel01120  Microbial metabolism in diverse environments
mel01130  Biosynthesis of antibiotics
mel01200  Carbon metabolism
Module
mel_M00357  Methanogenesis, acetate => methane
mel_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metbo_1898
   00620 Pyruvate metabolism
    Metbo_1898
   00640 Propanoate metabolism
    Metbo_1898
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metbo_1898
   00680 Methane metabolism
    Metbo_1898
Enzymes [BR:mel01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Metbo_1898
Lipid biosynthesis proteins [BR:mel01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Metbo_1898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N KNOX1
Motif
Other DBs
NCBI-ProteinID: ADZ10118
JGI: Metbo_1898
UniProt: F0TAP6
Position
complement(1947713..1949614)
Genome map
AA seq 633 aa AA seqDB search
MKRDTTVLLDEKRIFKPDVETVERAHVKNWENEIEKGKNFEAYWEEKAEELEWFEKWDKV
LDETNKPFYQWYVNGKINLTYNAVDRWIYTEKRNQVAILYINERGDEEKLTYYELYRQVN
KMANGLKNLGVNKGDTVSMYLPMCPELLISMLACAKIGAVHSVVYSGLSVGAFVERMNDA
NAKILITADGTYRRGKIINLKKISDEALLQCPTIETVIVLKHTGSEINVSDLSGREIFYD
RFLEGEPAECEPEWMDAEDPLFILYTSGSTGKPKGVLHTTGGYMVGVATTLKNIFDIQKD
DLWWCTGDIGWITGHSYVIYGPLLLGTTTIVYEGAPDYPDPGAWWKIIEKHGVTKFYTAP
TAIRHLMRFGNKYPNIYNLSSLRILGTVGEPINPEAWMWFYKNVGKEKTPIMDTWWQTET
GMHLISPLPSAHLKPGSATKPFPGVDADVVDEDGNPVPLGKGGYLVIKKPWPAMFRTLYE
DEERFQQVYWNQIPGVYKAGDMARKDEDGYFWIQGRSDDVLKIAGHRVGTAEVESAFVSH
PAVAEAAVIGKSDPIKGQVIKAFLILKEGYQLKTKLIEELNKHVRYELGPVAVIGEMEQV
EKLPKTRSGKIMRRLLRAKESGEDLGDTSTLEE
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgatacaaccgttcttctagatgagaaaagaattttcaaacccgatgttgaa
actgtggaacgggcccacgtaaaaaattgggaaaatgagattgagaagggaaaaaacttc
gaggcttactgggaagaaaaagcagaagaattagaatggttcgagaaatgggataaagta
ctcgacgaaacaaacaaaccattctaccaatggtacgtaaatggaaagataaatctcacc
tacaacgcagtagaccggtggatatacactgaaaaaagaaatcaagttgccatactgtac
ataaatgaaaggggtgacgaagaaaaactcacctactacgagctctacagacaagtaaac
aaaatggctaacggcctgaaaaacctaggagttaataagggagacacagtatccatgtac
ctgccgatgtgtccggaacttctaatatcaatgctggcatgtgcaaagatcggggctgtt
cacagtgttgtgtactcaggactaagtgtaggtgcatttgtggagagaatgaatgatgcc
aacgctaaaatactcataactgcagatggaacctacagaagaggaaaaataataaacctc
aaaaaaataagtgacgaagcacttctccagtgccccacaatcgaaacagtaattgtcctt
aaacacacaggaagcgaaataaatgtatcggacttgagtggaagagaaatattctacgac
agatttttagagggagaacccgcagaatgcgaaccagaatggatggatgccgaagatccg
ttgttcatactctacacctctggaagcacaggaaaacccaagggagttctacacacaact
ggaggttacatggtgggcgtggcaacaaccctcaaaaatatcttcgacatacaaaaggat
gatctctggtggtgtacaggagacataggatggatcacaggacacagctacgtaatatac
ggaccactactccttggaacaaccaccatagtctatgagggagcaccagactacccggac
cctggtgcctggtggaaaataatcgaaaaacacggagtgaccaaattttacacggcacca
acagccataagacaccttatgcgatttggaaacaagtaccctaatatttacaacctatcc
tcgttgagaatattgggaacggtgggagaacccataaatccagaggcatggatgtggttt
tacaaaaacgttggaaaggaaaagacacccatcatggacacatggtggcagacagaaaca
ggaatgcatttaatatcacccctgccatcagcccatcttaaacctggttctgcaaccaaa
ccatttccaggtgtagatgcagatgtggttgacgaagacggaaatccagtaccccttgga
aagggaggttacctcgtcatcaaaaaaccatggccagccatgttcagaaccctttacgag
gatgaagaaaggtttcaacaagtgtactggaaccagattcccggagtttacaaggcaggg
gacatggcaagaaaagatgaagatggatacttctggatacagggaagatccgacgatgta
ctcaaaattgcagggcacagggtgggaaccgccgaagtagaatcagcatttgtaagccac
cctgctgtggcagaagcagcagtaataggaaaatccgacccaatcaagggacaggtaatc
aaagcgtttctgatactcaaggaaggctaccaactaaaaacgaaactaatcgaagaactg
aacaaacacgtgagatatgaacttggaccagtggcagtcatcggtgaaatggaacaggtg
gaaaaactaccaaaaacccgaagtggaaaaattatgcggagattactcagggccaaggaa
tccggagaggatcttggggacacatcaacactcgaagaataa

DBGET integrated database retrieval system